BS26327.complete Sequence
461 bp assembled on 2011-08-24
GenBank Submission: KX801960
> BS26327.complete
GAAGTTATCAGTCGACATGTGCATTTGCTCAACTCGTGTACTCAAAATCG
TTCTTTTGGCATTCATACATCTTGCCGCAGGATTTAATGGCGCGCAAATA
GCGAAGGACATTACTTTGCTGGATAAACTGGTGGGTCACCATCATGTTAT
GCTTACTATAAGTCTAGCACTATGTGTTATCATACTAGTTGTTCTCTTAG
TTGCCATTTTTGCTGCTATTCGTCATCATATATTGGCTTTAAACGTGACG
CTTGTTTTCTTGATTTTTAAGTGTGTAGCAAAGGGTATTATCGTAATCGT
TTGCGTATTAACCGCAGAAACAGGTATTGAAAATACTGCCGCACATTTTT
GGTTCTTTCTATGCTGGAAATTCACGTGTTGCTGTATGCTCTTTAATCTA
TTCTTTTATATACGGCTAACAGAGAATTCAAGACAAGCTGACTAAAAGCT
TTCTAGACCAT
BS26327.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42660-RB | 429 | CG42660-PB | 1..429 | 17..445 | 2145 | 100 | Plus |
CG42660-RA | 429 | CG42660-PA | 1..429 | 17..445 | 2145 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42661-RB | 2597 | CG42661-RB | 44..472 | 17..445 | 2145 | 100 | Plus |
CG42661-RA | 2531 | CG42661-RA | 44..472 | 17..445 | 2145 | 100 | Plus |
CG42660-RB | 2597 | CG42660-RB | 44..472 | 17..445 | 2145 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7465670..7465837 | 80..247 | 840 | 100 | Plus |
3L | 28110227 | 3L | 7465900..7466029 | 247..376 | 650 | 100 | Plus |
3L | 28110227 | 3L | 7466086..7466155 | 376..445 | 350 | 100 | Plus |
3L | 28110227 | 3L | 7465552..7465615 | 17..80 | 320 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 21:34:01 has no hits.
BS26327.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:03 Download gff for
BS26327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tsp66A-RD | 44..470 | 17..443 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:20 Download gff for
BS26327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42660-RA | 44..470 | 17..443 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:36 Download gff for
BS26327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42660-RB | 44..470 | 17..443 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:36 Download gff for
BS26327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7465552..7465614 | 17..79 | 100 | -> | Plus |
3L | 7465670..7465837 | 80..247 | 100 | -> | Plus |
3L | 7465901..7466029 | 248..376 | 100 | -> | Plus |
3L | 7466087..7466153 | 377..443 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:20 Download gff for
BS26327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7458652..7458714 | 17..79 | 100 | -> | Plus |
arm_3L | 7458770..7458937 | 80..247 | 100 | -> | Plus |
arm_3L | 7459001..7459129 | 248..376 | 100 | -> | Plus |
arm_3L | 7459187..7459253 | 377..443 | 100 | | Plus |
BS26327.pep Sequence
Translation from 16 to 444
> BS26327.pep
MCICSTRVLKIVLLAFIHLAAGFNGAQIAKDITLLDKLVGHHHVMLTISL
ALCVIILVVLLVAIFAAIRHHILALNVTLVFLIFKCVAKGIIVIVCVLTA
ETGIENTAAHFWFFLCWKFTCCCMLFNLFFYIRLTENSRQAD*
BS26327.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42660-PB | 142 | CG42660-PB | 1..142 | 1..142 | 735 | 100 | Plus |
CG42660-PA | 142 | CG42660-PA | 1..142 | 1..142 | 735 | 100 | Plus |
CG42661-PB | 141 | CG42661-PB | 1..133 | 1..134 | 283 | 45.5 | Plus |
CG42661-PA | 141 | CG42661-PA | 1..133 | 1..134 | 283 | 45.5 | Plus |