Clone BS26327 Report

Search the DGRC for BS26327

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG42660-RA
Protein status:BS26327.pep: full length peptide match
Sequenced Size:461

Clone Sequence Records

BS26327.complete Sequence

461 bp assembled on 2011-08-24

GenBank Submission: KX801960

> BS26327.complete
GAAGTTATCAGTCGACATGTGCATTTGCTCAACTCGTGTACTCAAAATCG
TTCTTTTGGCATTCATACATCTTGCCGCAGGATTTAATGGCGCGCAAATA
GCGAAGGACATTACTTTGCTGGATAAACTGGTGGGTCACCATCATGTTAT
GCTTACTATAAGTCTAGCACTATGTGTTATCATACTAGTTGTTCTCTTAG
TTGCCATTTTTGCTGCTATTCGTCATCATATATTGGCTTTAAACGTGACG
CTTGTTTTCTTGATTTTTAAGTGTGTAGCAAAGGGTATTATCGTAATCGT
TTGCGTATTAACCGCAGAAACAGGTATTGAAAATACTGCCGCACATTTTT
GGTTCTTTCTATGCTGGAAATTCACGTGTTGCTGTATGCTCTTTAATCTA
TTCTTTTATATACGGCTAACAGAGAATTCAAGACAAGCTGACTAAAAGCT
TTCTAGACCAT

BS26327.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42660-RB 429 CG42660-PB 1..429 17..445 2145 100 Plus
CG42660-RA 429 CG42660-PA 1..429 17..445 2145 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RB 2597 CG42661-RB 44..472 17..445 2145 100 Plus
CG42661-RA 2531 CG42661-RA 44..472 17..445 2145 100 Plus
CG42660-RB 2597 CG42660-RB 44..472 17..445 2145 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7465670..7465837 80..247 840 100 Plus
3L 28110227 3L 7465900..7466029 247..376 650 100 Plus
3L 28110227 3L 7466086..7466155 376..445 350 100 Plus
3L 28110227 3L 7465552..7465615 17..80 320 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:34:01 has no hits.

BS26327.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:03 Download gff for BS26327.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RD 44..470 17..443 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:20 Download gff for BS26327.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RA 44..470 17..443 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:36 Download gff for BS26327.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RB 44..470 17..443 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:36 Download gff for BS26327.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7465552..7465614 17..79 100 -> Plus
3L 7465670..7465837 80..247 100 -> Plus
3L 7465901..7466029 248..376 100 -> Plus
3L 7466087..7466153 377..443 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:20 Download gff for BS26327.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7458652..7458714 17..79 100 -> Plus
arm_3L 7458770..7458937 80..247 100 -> Plus
arm_3L 7459001..7459129 248..376 100 -> Plus
arm_3L 7459187..7459253 377..443 100   Plus

BS26327.pep Sequence

Translation from 16 to 444

> BS26327.pep
MCICSTRVLKIVLLAFIHLAAGFNGAQIAKDITLLDKLVGHHHVMLTISL
ALCVIILVVLLVAIFAAIRHHILALNVTLVFLIFKCVAKGIIVIVCVLTA
ETGIENTAAHFWFFLCWKFTCCCMLFNLFFYIRLTENSRQAD*

BS26327.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42660-PB 142 CG42660-PB 1..142 1..142 735 100 Plus
CG42660-PA 142 CG42660-PA 1..142 1..142 735 100 Plus
CG42661-PB 141 CG42661-PB 1..133 1..134 283 45.5 Plus
CG42661-PA 141 CG42661-PA 1..133 1..134 283 45.5 Plus