BS26328.complete Sequence
494 bp assembled on 2011-08-24
GenBank Submission: KX805883
> BS26328.complete
GAAGTTATCAGTCGACATGGCAGTCGAGGAATTAGAGAGCAAAATTGTCC
AACTGTTCGTAGAGAACCCCCTCCTGCGCTACGGTGCTGTTGGTCTGTGC
GCCATCTACCTGATCTTTGGCTGGGGCGCCCAACTACTGTGCAACATCAT
TGGGGTTCTGTACCCTGCATATATTTCCATCCATGCCATCGAGTCCAGCA
CAAAGCAGGACGACACCAAGTGGCTGATCTACTGGGTCACGTTTGGAATC
TTCACCGTGATTGAATTCTTTTCGAGTCTGCTAACTTCGGTGATTCCCTT
TTACTGGCTGCTGAAGTGTGCTTTCCTCATCTGGTGCATGCTGCCCACGG
AACAGAATGGTTCTACCATCATCTACAACAAGCTGGTGCGACCCTACTTC
CTGAAACATCACGAATCCGTTGACAGGATCATCGATGATGGCATGAAGAA
AGCCGCTGGAGTGCTGAAGCATGACTAGAAGCTTTCTAGACCAT
BS26328.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8331-RC | 462 | CG8331-PC | 1..462 | 17..478 | 2310 | 100 | Plus |
CG8331-RD | 537 | CG8331-PD | 142..537 | 83..478 | 1980 | 100 | Plus |
CG8331-RB | 483 | CG8331-PB | 88..483 | 83..478 | 1980 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8331-RC | 1023 | CG8331-RC | 370..836 | 15..481 | 2335 | 100 | Plus |
CG8331-RD | 846 | CG8331-RD | 261..659 | 83..481 | 1995 | 100 | Plus |
CG8331-RB | 877 | CG8331-RB | 292..690 | 83..481 | 1995 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 14172289..14172522 | 83..316 | 1170 | 100 | Plus |
3R | 32079331 | 3R | 25786726..25787057 | 429..98 | 1090 | 88.6 | Minus |
2R | 25286936 | 2R | 14172582..14172683 | 315..416 | 510 | 100 | Plus |
2R | 25286936 | 2R | 14172158..14172228 | 15..85 | 355 | 100 | Plus |
2R | 25286936 | 2R | 14172747..14172811 | 417..481 | 325 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 21:34:28 has no hits.
BS26328.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:03 Download gff for
BS26328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8331-RC | 8..469 | 17..478 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:35 Download gff for
BS26328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8331-RC | 372..833 | 17..478 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:48 Download gff for
BS26328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8331-RC | 372..833 | 17..478 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:48 Download gff for
BS26328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14172160..14172226 | 17..83 | 100 | -> | Plus |
2R | 14172290..14172522 | 84..316 | 100 | -> | Plus |
2R | 14172584..14172683 | 317..416 | 100 | -> | Plus |
2R | 14172747..14172808 | 417..478 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:35 Download gff for
BS26328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 10060089..10060188 | 317..416 | 100 | -> | Plus |
arm_2R | 10060252..10060313 | 417..478 | 100 | | Plus |
arm_2R | 10059665..10059731 | 17..83 | 100 | -> | Plus |
arm_2R | 10059795..10060027 | 84..316 | 100 | -> | Plus |
BS26328.pep Sequence
Translation from 16 to 477
> BS26328.pep
MAVEELESKIVQLFVENPLLRYGAVGLCAIYLIFGWGAQLLCNIIGVLYP
AYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLK
CAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKAAGVL
KHD*
BS26328.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8331-PC | 153 | CG8331-PC | 1..153 | 1..153 | 812 | 100 | Plus |
CG8331-PB | 160 | CG8331-PB | 27..160 | 20..153 | 707 | 98.5 | Plus |
CG8331-PD | 178 | CG8331-PD | 48..178 | 23..153 | 706 | 100 | Plus |
CG8331-PA | 178 | CG8331-PA | 48..178 | 23..153 | 706 | 100 | Plus |
CG4960-PB | 174 | CG4960-PB | 33..174 | 2..153 | 536 | 69.1 | Plus |