Clone BS26328 Report

Search the DGRC for BS26328

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG8331-RC
Protein status:BS26328.pep: gold
Sequenced Size:494

Clone Sequence Records

BS26328.complete Sequence

494 bp assembled on 2011-08-24

GenBank Submission: KX805883

> BS26328.complete
GAAGTTATCAGTCGACATGGCAGTCGAGGAATTAGAGAGCAAAATTGTCC
AACTGTTCGTAGAGAACCCCCTCCTGCGCTACGGTGCTGTTGGTCTGTGC
GCCATCTACCTGATCTTTGGCTGGGGCGCCCAACTACTGTGCAACATCAT
TGGGGTTCTGTACCCTGCATATATTTCCATCCATGCCATCGAGTCCAGCA
CAAAGCAGGACGACACCAAGTGGCTGATCTACTGGGTCACGTTTGGAATC
TTCACCGTGATTGAATTCTTTTCGAGTCTGCTAACTTCGGTGATTCCCTT
TTACTGGCTGCTGAAGTGTGCTTTCCTCATCTGGTGCATGCTGCCCACGG
AACAGAATGGTTCTACCATCATCTACAACAAGCTGGTGCGACCCTACTTC
CTGAAACATCACGAATCCGTTGACAGGATCATCGATGATGGCATGAAGAA
AGCCGCTGGAGTGCTGAAGCATGACTAGAAGCTTTCTAGACCAT

BS26328.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331-RC 462 CG8331-PC 1..462 17..478 2310 100 Plus
CG8331-RD 537 CG8331-PD 142..537 83..478 1980 100 Plus
CG8331-RB 483 CG8331-PB 88..483 83..478 1980 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331-RC 1023 CG8331-RC 370..836 15..481 2335 100 Plus
CG8331-RD 846 CG8331-RD 261..659 83..481 1995 100 Plus
CG8331-RB 877 CG8331-RB 292..690 83..481 1995 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14172289..14172522 83..316 1170 100 Plus
3R 32079331 3R 25786726..25787057 429..98 1090 88.6 Minus
2R 25286936 2R 14172582..14172683 315..416 510 100 Plus
2R 25286936 2R 14172158..14172228 15..85 355 100 Plus
2R 25286936 2R 14172747..14172811 417..481 325 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:34:28 has no hits.

BS26328.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:03 Download gff for BS26328.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 8..469 17..478 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:35 Download gff for BS26328.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 372..833 17..478 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:48 Download gff for BS26328.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 372..833 17..478 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:48 Download gff for BS26328.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14172160..14172226 17..83 100 -> Plus
2R 14172290..14172522 84..316 100 -> Plus
2R 14172584..14172683 317..416 100 -> Plus
2R 14172747..14172808 417..478 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:35 Download gff for BS26328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10060089..10060188 317..416 100 -> Plus
arm_2R 10060252..10060313 417..478 100   Plus
arm_2R 10059665..10059731 17..83 100 -> Plus
arm_2R 10059795..10060027 84..316 100 -> Plus

BS26328.pep Sequence

Translation from 16 to 477

> BS26328.pep
MAVEELESKIVQLFVENPLLRYGAVGLCAIYLIFGWGAQLLCNIIGVLYP
AYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLK
CAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKAAGVL
KHD*

BS26328.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331-PC 153 CG8331-PC 1..153 1..153 812 100 Plus
CG8331-PB 160 CG8331-PB 27..160 20..153 707 98.5 Plus
CG8331-PD 178 CG8331-PD 48..178 23..153 706 100 Plus
CG8331-PA 178 CG8331-PA 48..178 23..153 706 100 Plus
CG4960-PB 174 CG4960-PB 33..174 2..153 536 69.1 Plus