Clone BS26330 Report

Search the DGRC for BS26330

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:30
Vector:pDNR-Dual
Associated Gene/Transcriptdlg1-RO
Protein status:BS26330.pep: full length peptide match
Sequenced Size:653

Clone Sequence Records

BS26330.complete Sequence

653 bp assembled on 2011-08-24

GenBank Submission: KX805300

> BS26330.complete
GAAGTTATCAGTCGACATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTC
TCGAGCTGCTCGAGGACTACCACGCGAGACTTTCGGAGCCGCAGGATCGG
GCGCTGCGTATTGCAATCGAACGCGTTATACGCATATTTAAATCTCGCTT
GTTTCAAGCGCTGTTAGATATACAAGAATTCTATGAATTGACATTATTGG
ATGACTCGAAGAGCATACAACAAAAGACAGCGGAGACCTTGCAAATTGCA
ACCAAATGGGAAAAGGATGGCCAGGCAGTCAAAATAGCTGATAATCAGCG
CATGCGCATCGAATCGGACACGGAAAATGCCAAGGAGCCAACTGTCGAGC
AGCAGCAAAAGCAGCAGCAAGCGCAGCAGCGCAGTTCCCGCTCCCCGCAG
CAGCAGAATCCGCAGCAGCAGCAGGGATCCAAATCGAGGAGCGGGTCCCA
GACTATACAGATACAGTCACTTACACAGACATACCCAAACGCACACCAGC
GCAAGCGAGTCCTCGTGAGCCTCCATCCACATCAACATCAACATCAAAGC
CAAATTCAACACCAACACCATTACCAACTTCGCCATAACAACGGCATTCA
AGCCAAAATGCTTAAGCGCGCTTTTGAGTCCACCTAGAAGCTTTCTAGAC
CAT

BS26330.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RO 621 CG1725-PO 1..621 17..637 3105 100 Plus
dlg1-RI 627 CG1725-PI 1..627 17..637 3010 99 Plus
dlg1-RJ 627 CG1725-PJ 1..627 17..637 3010 99 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RO 2363 CG1725-RO 626..1246 17..637 3105 100 Plus
dlg1-RI 2114 CG1725-RI 371..997 17..637 3010 99 Plus
dlg1-RJ 2102 CG1725-RJ 359..985 17..637 3010 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387992..11388174 455..637 915 100 Plus
X 23542271 X 11387772..11387933 293..454 810 100 Plus
X 23542271 X 11376840..11376973 34..167 670 100 Plus
X 23542271 X 11381854..11381980 166..292 635 100 Plus
Blast to na_te.dros performed 2014-11-26 21:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2538 348..578 237 60 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 549..634 524..608 130 62.8 Plus
rover 7318 rover ROVER 7318bp 1930..1997 539..606 123 68.1 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 2371..2410 447..489 107 81.4 Plus
TART-C 11124 TART-C TARTC 11124bp 1615..1654 447..489 107 81.4 Plus

BS26330.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:05 Download gff for BS26330.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 598..1218 17..637 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:05 Download gff for BS26330.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 626..1246 17..637 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:21 Download gff for BS26330.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 626..1246 17..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:21 Download gff for BS26330.complete
Subject Subject Range Query Range Percent Splice Strand
X 11387772..11387933 293..454 100 -> Plus
X 11387992..11388174 455..637 100   Plus
X 11374492..11374510 17..35 100 -> Plus
X 11376842..11376973 36..167 100 -> Plus
X 11381856..11381980 168..292 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:05 Download gff for BS26330.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11268525..11268543 17..35 100 -> Plus
arm_X 11270875..11271006 36..167 100 -> Plus
arm_X 11275889..11276013 168..292 100 -> Plus
arm_X 11281805..11281966 293..454 100 -> Plus
arm_X 11282025..11282207 455..637 100   Plus

BS26330.pep Sequence

Translation from 16 to 636

> BS26330.pep
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQAQQRSSRSPQQQNPQQQQGSKSRSGSQTIQIQ
SLTQTYPNAHQRKRVLVSLHPHQHQHQSQIQHQHHYQLRHNNGIQAKMLK
RAFEST*

BS26330.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PO 206 CG1725-PO 1..206 1..206 1046 100 Plus
dlg1-PI 208 CG1725-PI 1..208 1..206 1033 99 Plus
dlg1-PJ 208 CG1725-PJ 1..208 1..206 1033 99 Plus
dlg1-PC 208 CG1725-PC 1..208 1..206 1033 99 Plus
dlg1-PU 198 CG1725-PU 1..198 1..206 991 96.1 Plus