Clone BS26337 Report

Search the DGRC for BS26337

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptSfp38D-RA
Protein status:BS26337.pep: gold
Sequenced Size:542

Clone Sequence Records

BS26337.complete Sequence

542 bp assembled on 2011-08-24

GenBank Submission: KX800276

> BS26337.complete
GAAGTTATCAGTCGACATGAAGTTTATGGCAATATGCCTATTGGCAAATA
TTGGCTACATACTTGGCACTACAATTGGCCAGCTTAATGACGAAGCCACA
ATTCGACTAAAGGGACTTGTGGAGAAATATAAACTGCAAGCTCTTAGCAA
TCCCGAATTCTCTCAGTGGATTGGCAAACTTGAGAAAACTAGCAAGTCGA
GAAGATTGGAAGACAAAATGAAGGTCAAAGCTGAATTTAAAAACTACGAC
GAACGTCGCTTGCAATTGGAAAATAAAATTAGGGAACGCATTACGGCGAT
CGATGACCTCATATCCGATATTATGGCCAAAGTCCCGATAAAGGATAAAG
GGTGTCTCAAGTATTACCAACGCCAGAAAAGATCCCTTAAATTGGCCCAC
AATTTTTCGAATTTAACTAAGCAAACAAACCTCATACGCAACTCGAAACA
ATGCGAAACAACTAAAGTGCAGTCTAGTGAACTAAGTGAAAGCTCTGAAA
ATCCGGATGAGTATAGTTATTACTAAAAGCTTTCTAGACCAT

BS26337.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D-RB 510 CG42606-PB 1..510 17..526 2550 100 Plus
Sfp38D-RA 510 CG42606-PA 1..510 17..526 2550 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D-RB 1234 CG3-RB 24..533 17..526 2550 100 Plus
Sfp38D-RA 640 CG42606-RA 24..533 17..526 2550 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20641049..20641515 60..526 2335 100 Plus
2L 23513712 2L 20640940..20640982 17..59 215 100 Plus
Blast to na_te.dros performed 2014-11-26 21:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 207..331 525..400 113 60.8 Minus

BS26337.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:07 Download gff for BS26337.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 24..531 17..524 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:32 Download gff for BS26337.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 24..531 17..524 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:49 Download gff for BS26337.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 24..531 17..524 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:49 Download gff for BS26337.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20640940..20640982 17..59 100 -> Plus
2L 20641049..20641513 60..524 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:32 Download gff for BS26337.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20640940..20640982 17..59 100 -> Plus
arm_2L 20641049..20641513 60..524 100   Plus

BS26337.pep Sequence

Translation from 16 to 525

> BS26337.pep
MKFMAICLLANIGYILGTTIGQLNDEATIRLKGLVEKYKLQALSNPEFSQ
WIGKLEKTSKSRRLEDKMKVKAEFKNYDERRLQLENKIRERITAIDDLIS
DIMAKVPIKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCETTK
VQSSELSESSENPDEYSYY*

BS26337.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D-PB 169 CG42606-PB 1..169 1..169 858 100 Plus
Sfp38D-PA 169 CG42606-PA 1..169 1..169 858 100 Plus
CG17472-PA 159 CG17472-PA 1..142 1..146 232 36.1 Plus
CG31680-PA 147 CG31680-PA 1..129 1..146 211 33.6 Plus