Clone BS26339 Report

Search the DGRC for BS26339

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptCG43056-RA
Protein status:BS26339.pep: gold
Sequenced Size:281

Clone Sequence Records

BS26339.complete Sequence

281 bp assembled on 2011-08-24

GenBank Submission: KX803706

> BS26339.complete
GAAGTTATCAGTCGACATGAAGTTACTCTGGCTGCTGTTAGTGGGCGTTG
TTGCCGGGCAACCTTGTGATAAGCTCTGTCCCATCAATAATAACTTCGGA
TGTGTCAGCAAGGACAATAAATGCTTTTACACCGTTCGCAATCCATGTAT
TTTGAAGGCCATTAACTGCTATCGTAAATCGAAGAACTTATCTGTTTTGA
AGCCCATTTTGCGCAGCAAGTGCACCAATAAGGAAGTTCCAGTTTGCGAG
AATATCAATAAATAGAAGCTTTCTAGACCAT

BS26339.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG43056-RA 249 CG43056-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG43056-RA 303 CG43056-RA 33..281 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4437905..4438055 44..194 755 100 Plus
2L 23513712 2L 4438108..4438179 194..265 360 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:37:21 has no hits.

BS26339.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:08 Download gff for BS26339.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 33..275 17..259 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:46 Download gff for BS26339.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 33..275 17..259 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:00 Download gff for BS26339.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 33..275 17..259 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:00 Download gff for BS26339.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4437819..4437846 17..44 100 -> Plus
2L 4437906..4438055 45..194 100 -> Plus
2L 4438109..4438173 195..259 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:46 Download gff for BS26339.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4437819..4437846 17..44 100 -> Plus
arm_2L 4437906..4438055 45..194 100 -> Plus
arm_2L 4438109..4438173 195..259 100   Plus

BS26339.pep Sequence

Translation from 16 to 264

> BS26339.pep
MKLLWLLLVGVVAGQPCDKLCPINNNFGCVSKDNKCFYTVRNPCILKAIN
CYRKSKNLSVLKPILRSKCTNKEVPVCENINK*

BS26339.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG43056-PA 82 CG43056-PA 1..82 1..82 450 100 Plus