BS26339.complete Sequence
281 bp assembled on 2011-08-24
GenBank Submission: KX803706
> BS26339.complete
GAAGTTATCAGTCGACATGAAGTTACTCTGGCTGCTGTTAGTGGGCGTTG
TTGCCGGGCAACCTTGTGATAAGCTCTGTCCCATCAATAATAACTTCGGA
TGTGTCAGCAAGGACAATAAATGCTTTTACACCGTTCGCAATCCATGTAT
TTTGAAGGCCATTAACTGCTATCGTAAATCGAAGAACTTATCTGTTTTGA
AGCCCATTTTGCGCAGCAAGTGCACCAATAAGGAAGTTCCAGTTTGCGAG
AATATCAATAAATAGAAGCTTTCTAGACCAT
BS26339.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43056-RA | 249 | CG43056-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43056-RA | 303 | CG43056-RA | 33..281 | 17..265 | 1245 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:37:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4437905..4438055 | 44..194 | 755 | 100 | Plus |
2L | 23513712 | 2L | 4438108..4438179 | 194..265 | 360 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 21:37:21 has no hits.
BS26339.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:08 Download gff for
BS26339.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 33..275 | 17..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:46 Download gff for
BS26339.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 33..275 | 17..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:00 Download gff for
BS26339.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 33..275 | 17..259 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:00 Download gff for
BS26339.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4437819..4437846 | 17..44 | 100 | -> | Plus |
2L | 4437906..4438055 | 45..194 | 100 | -> | Plus |
2L | 4438109..4438173 | 195..259 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:46 Download gff for
BS26339.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4437819..4437846 | 17..44 | 100 | -> | Plus |
arm_2L | 4437906..4438055 | 45..194 | 100 | -> | Plus |
arm_2L | 4438109..4438173 | 195..259 | 100 | | Plus |
BS26339.pep Sequence
Translation from 16 to 264
> BS26339.pep
MKLLWLLLVGVVAGQPCDKLCPINNNFGCVSKDNKCFYTVRNPCILKAIN
CYRKSKNLSVLKPILRSKCTNKEVPVCENINK*
BS26339.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43056-PA | 82 | CG43056-PA | 1..82 | 1..82 | 450 | 100 | Plus |