Clone BS26344 Report

Search the DGRC for BS26344

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG42831-RA
Protein status:BS26344.pep: full length peptide match
Sequenced Size:407

Clone Sequence Records

BS26344.complete Sequence

407 bp assembled on 2011-08-24

GenBank Submission: KX806422

> BS26344.complete
GAAGTTATCAGTCGACATGGCGCTAATAAATGCTTATCGAAGACGCATAA
AGCGAGTAAATTCGCAGCCATTAAACGGGCATAAAACTCGAAGCCGGGGC
CGAAGCGAAATTGTGGGGCCGACAAATCAAAGTACAAGCCTCAGGACCAA
CCTCATTCTCCTATTTCCCAGCCATGAAATAAAACCAGGCAACAATGAAA
CCCAAAGCGTCTCCCAAGCGATTTCAATGCGGGCATTCATCGGTCGAGCC
AAGGAATTGGCCACCCACAAGACCCAAAACCCAGAACCCAAACTTCCAGT
GAACCTTCCACCCTCGTCACCTCCAGCACCCCATTTAAAGGCCCTTCCTT
CGAGGCAACACTCGCTATATAACCATCTTACCCAACGTTGAAAGCTTTCT
AGACCAT

BS26344.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-RA 375 CG42831-PA 1..375 17..391 1875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-RA 1266 CG42831-RA 250..629 16..395 1885 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10815068..10815447 16..395 1885 99.7 Plus
Blast to na_te.dros performed on 2014-11-26 21:38:23 has no hits.

BS26344.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:10 Download gff for BS26344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 251..624 17..390 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:32:13 Download gff for BS26344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 251..624 17..390 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:26 Download gff for BS26344.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 251..624 17..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:26 Download gff for BS26344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10815069..10815442 17..390 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:32:13 Download gff for BS26344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10808169..10808542 17..390 100   Plus

BS26344.pep Sequence

Translation from 16 to 390

> BS26344.pep
MALINAYRRRIKRVNSQPLNGHKTRSRGRSEIVGPTNQSTSLRTNLILLF
PSHEIKPGNNETQSVSQAISMRAFIGRAKELATHKTQNPEPKLPVNLPPS
SPPAPHLKALPSRQHSLYNHLTQR*

BS26344.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-PA 124 CG42831-PA 1..124 1..124 640 100 Plus