Clone BS26346 Report

Search the DGRC for BS26346

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG42703-RA
Protein status:BS26346.pep: full length peptide match
Sequenced Size:269

Clone Sequence Records

BS26346.complete Sequence

269 bp assembled on 2011-08-24

GenBank Submission: KX802902

> BS26346.complete
GAAGTTATCAGTCGACATGTCGAATATACTTGCTGCCAAACTCGACTGCC
AATGCGCCGGAAAAAACAGTCCCATGGATTCGGTGATAGTGCCGATTACC
CAGGAACTGAAGTGCATGCAAAAACTGGTCAAAAGGGTAAGACATTTTCA
AATGGCCAGGCTTTTCCAAAGCGAATCTGAGATGTACGCTGAAGAACTAA
AGGCCCGGAATCTTGCCATTTGGCGTGAACCTGATTATCGATACTGCAAG
TGAAAGCTTTCTAGACCAT

BS26346.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG42703-RA 237 CG42703-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG42703-RA 488 CG42703-RA 86..322 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23101398..23101623 253..28 1130 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:36:11 has no hits.

BS26346.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:06 Download gff for BS26346.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 10..245 17..252 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:19 Download gff for BS26346.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 86..321 17..252 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:36 Download gff for BS26346.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 86..321 17..252 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:36 Download gff for BS26346.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23101399..23101630 20..252 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:19 Download gff for BS26346.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18988922..18989153 20..252 98   Minus

BS26346.pep Sequence

Translation from 16 to 252

> BS26346.pep
MSNILAAKLDCQCAGKNSPMDSVIVPITQELKCMQKLVKRVRHFQMARLF
QSESEMYAEELKARNLAIWREPDYRYCK*

BS26346.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42703-PA 78 CG42703-PA 1..78 1..78 409 100 Plus