Clone BS26349 Report

Search the DGRC for BS26349

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG42615-RB
Protein status:BS26349.pep: gold
Sequenced Size:236

Clone Sequence Records

BS26349.complete Sequence

236 bp assembled on 2011-08-24

GenBank Submission: KX805460

> BS26349.complete
GAAGTTATCAGTCGACATGGACCACAAGAAAACGTTAACCTGGTTTTTCA
GCCTGTCATCGGTGCGCTACGCGCAGATCTTTATCGTAATGGCGGTCGAT
CTGCTGACCCTGTCCAATCTGTATCCCAAGCACTCGAGCTACATTGCGCG
TCCATTCCTACTCTGGCAGGATCTTCAGGAGGAGGACGAACGTAGCTTGG
ACTCACCCCAGCAATTCTAAAAGCTTTCTAGACCAT

BS26349.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-RB 204 CG42615-PB 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-RB 421 CG42615-RB 58..261 17..220 1020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8737427..8737630 17..220 1020 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:39:55 has no hits.

BS26349.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:12 Download gff for BS26349.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 58..259 17..218 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:33:00 Download gff for BS26349.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 58..259 17..218 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:01 Download gff for BS26349.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 58..259 17..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:01 Download gff for BS26349.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8737427..8737628 17..218 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:33:00 Download gff for BS26349.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4624932..4625133 17..218 100   Plus

BS26349.pep Sequence

Translation from 16 to 219

> BS26349.pep
MDHKKTLTWFFSLSSVRYAQIFIVMAVDLLTLSNLYPKHSSYIARPFLLW
QDLQEEDERSLDSPQQF*

BS26349.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-PB 67 CG42615-PB 1..67 1..67 349 100 Plus