Clone BS26350 Report

Search the DGRC for BS26350

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG43104-RA
Protein status:BS26350.pep: full length peptide match
Sequenced Size:296

Clone Sequence Records

BS26350.complete Sequence

296 bp assembled on 2011-08-24

GenBank Submission: KX805174

> BS26350.complete
GAAGTTATCAGTCGACATGATCGATAACCAAGGACTTTTCATCTCACCAC
TGCAGTGTAGCTGCTTCGGCTGTAACAATTTGCGGAAATTAGCCAAGGTG
TTTTATGGTCATCACCATCGACTCACCCTCTGTCCACTATTACACTCATC
GGATAAAGGAGCCGTGGCACTGCGAAGTGGATTGTTGTCCGGCAACGTGG
AAATGTTTACTTTTTCTTCGGTTTGCTTTTCCAACACTCTGTACCGAACG
ATGAGCTGCCTTTGGGGGCTTTTTAATTGAAAGCTTTCTAGACCAT

BS26350.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 21:40:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 21:40:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16737220..16737443 280..57 1120 100 Minus
2R 25286936 2R 16737717..16737759 57..15 215 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:40:18 has no hits.

BS26350.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:13 Download gff for BS26350.complete
Subject Subject Range Query Range Percent Splice Strand
CG43104-RA 94..356 17..279 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:33:12 Download gff for BS26350.complete
Subject Subject Range Query Range Percent Splice Strand
CG43104-RA 94..356 17..279 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:11 Download gff for BS26350.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16737221..16737442 58..279 100 <- Minus
2R 16737717..16737757 17..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:11 Download gff for BS26350.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16737221..16737442 58..279 100 <- Minus
2R 16737717..16737757 17..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:33:12 Download gff for BS26350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12624726..12624947 58..279 100 <- Minus
arm_2R 12625222..12625262 17..57 100   Minus

BS26350.pep Sequence

Translation from 16 to 279

> BS26350.pep
MIDNQGLFISPLQCSCFGCNNLRKLAKVFYGHHHRLTLCPLLHSSDKGAV
ALRSGLLSGNVEMFTFSSVCFSNTLYRTMSCLWGLFN*
Sequence BS26350.pep has no blast hits.