Clone BS26351 Report

Search the DGRC for BS26351

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG43109-RA
Protein status:BS26351.pep: gold
Sequenced Size:206

Clone Sequence Records

BS26351.complete Sequence

206 bp assembled on 2011-08-24

GenBank Submission: KX803419

> BS26351.complete
GAAGTTATCAGTCGACATGTGGCTTCTCTGGTTTATTCTCCACCTAATTG
GCCTCATCCAAGGGCGTTCTGTGGGCGGTGGGTCTGTAAACTTGGATGAC
GAGTTTTTCATGCCTCAGCCAGATCCCACAATATTTGCCTACAATCAAAC
TGATAAGGGATCATCACCCTGGGACAATACCTGGAACTGAAAGCTTTCTA
GACCAT

BS26351.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG43109-RA 174 CG43109-PA 1..174 17..190 870 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG43109-RA 261 CG43109-RA 15..189 17..191 875 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18867920..18868009 191..102 450 100 Minus
2R 25286936 2R 18868067..18868153 103..17 435 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:40:44 has no hits.

BS26351.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:14 Download gff for BS26351.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 15..187 17..189 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:33:28 Download gff for BS26351.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 15..187 17..189 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:22 Download gff for BS26351.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 15..187 17..189 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:22 Download gff for BS26351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18867922..18868007 104..189 100 <- Minus
2R 18868067..18868153 17..103 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:33:28 Download gff for BS26351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14755427..14755512 104..189 100 <- Minus
arm_2R 14755572..14755658 17..103 100   Minus

BS26351.pep Sequence

Translation from 16 to 189

> BS26351.pep
MWLLWFILHLIGLIQGRSVGGGSVNLDDEFFMPQPDPTIFAYNQTDKGSS
PWDNTWN*

BS26351.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG43109-PA 57 CG43109-PA 1..57 1..57 324 100 Plus