Clone BS26358 Report

Search the DGRC for BS26358

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG42656-RA
Protein status:BS26358.pep: full length peptide match
Sequenced Size:191

Clone Sequence Records

BS26358.complete Sequence

191 bp assembled on 2011-08-24

GenBank Submission: KX804989

> BS26358.complete
GAAGTTATCAGTCGACATGGATGCACTTCTGAAAATTGTCTTGTTGATCA
GCTTGTATTTCATTGCAATAAGCCTGCACTTGGGATTGTGTGACGATGTT
CCTTCCGCCGAGGCAGACACAGTGGTAACTGAAAGTGAAGAGCACTACAC
CGCATCCGATGACTTCGACTATTAGAAGCTTTCTAGACCAT

BS26358.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42656-RA 159 CG42656-PA 1..159 17..175 795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42656-RA 255 CG42656-RA 29..194 10..175 815 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7493022..7493149 175..48 640 100 Minus
3R 32079331 3R 7493202..7493243 51..10 195 97.6 Minus
Blast to na_te.dros performed on 2014-11-26 21:39:15 has no hits.

BS26358.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:11 Download gff for BS26358.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 36..194 17..175 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:32:39 Download gff for BS26358.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 36..194 17..175 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:44 Download gff for BS26358.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 36..194 17..175 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:44 Download gff for BS26358.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7493022..7493145 52..175 100 <- Minus
3R 7493202..7493236 17..51 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:32:39 Download gff for BS26358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3318744..3318867 52..175 100 <- Minus
arm_3R 3318924..3318958 17..51 100   Minus

BS26358.pep Sequence

Translation from 16 to 174

> BS26358.pep
MDALLKIVLLISLYFIAISLHLGLCDDVPSAEADTVVTESEEHYTASDDF
DY*

BS26358.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG42656-PA 52 CG42656-PA 1..52 1..52 262 100 Plus