BS26358.complete Sequence
191 bp assembled on 2011-08-24
GenBank Submission: KX804989
> BS26358.complete
GAAGTTATCAGTCGACATGGATGCACTTCTGAAAATTGTCTTGTTGATCA
GCTTGTATTTCATTGCAATAAGCCTGCACTTGGGATTGTGTGACGATGTT
CCTTCCGCCGAGGCAGACACAGTGGTAACTGAAAGTGAAGAGCACTACAC
CGCATCCGATGACTTCGACTATTAGAAGCTTTCTAGACCAT
BS26358.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42656-RA | 159 | CG42656-PA | 1..159 | 17..175 | 795 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42656-RA | 255 | CG42656-RA | 29..194 | 10..175 | 815 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:39:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7493022..7493149 | 175..48 | 640 | 100 | Minus |
3R | 32079331 | 3R | 7493202..7493243 | 51..10 | 195 | 97.6 | Minus |
Blast to na_te.dros performed on 2014-11-26 21:39:15 has no hits.
BS26358.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:11 Download gff for
BS26358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 36..194 | 17..175 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:32:39 Download gff for
BS26358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 36..194 | 17..175 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:44 Download gff for
BS26358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 36..194 | 17..175 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:44 Download gff for
BS26358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7493022..7493145 | 52..175 | 100 | <- | Minus |
3R | 7493202..7493236 | 17..51 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:32:39 Download gff for
BS26358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 3318744..3318867 | 52..175 | 100 | <- | Minus |
arm_3R | 3318924..3318958 | 17..51 | 100 | | Minus |
BS26358.pep Sequence
Translation from 16 to 174
> BS26358.pep
MDALLKIVLLISLYFIAISLHLGLCDDVPSAEADTVVTESEEHYTASDDF
DY*
BS26358.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42656-PA | 52 | CG42656-PA | 1..52 | 1..52 | 262 | 100 | Plus |