Clone BS26378 Report

Search the DGRC for BS26378

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG42781-RA
Protein status:BS26378.pep: full length peptide match
Sequenced Size:152

Clone Sequence Records

BS26378.complete Sequence

152 bp assembled on 2011-08-24

GenBank Submission: KX802301

> BS26378.complete
GAAGTTATCAGTCGACATGTCCCCTGGCCACTTAATCCTGCTGCAGTTCA
GCATGCACTGTTTCAAGATCATTTTCATCTATTGCATCTGTGTTAATGTC
CTGGAGCATCTTGTTCAAAGCGTCCAGGAACACTGAAAGCTTTCTAGACC
AT

BS26378.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42781-RA 120 CG42781-PA 1..120 17..136 600 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42781-RA 258 CG42781-RA 83..204 16..137 610 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7382787..7382908 137..16 610 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:46:55 has no hits.

BS26378.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:24 Download gff for BS26378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 1..119 17..135 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:36:29 Download gff for BS26378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 50..168 17..135 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:05 Download gff for BS26378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 84..202 17..135 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:05 Download gff for BS26378.complete
Subject Subject Range Query Range Percent Splice Strand
X 7382789..7382907 17..135 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:36:29 Download gff for BS26378.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7276822..7276940 17..135 100   Minus

BS26378.pep Sequence

Translation from 16 to 135

> BS26378.pep
MSPGHLILLQFSMHCFKIIFIYCICVNVLEHLVQSVQEH*

BS26378.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42781-PA 39 CG42781-PA 1..39 1..39 211 100 Plus