BS26378.complete Sequence
152 bp assembled on 2011-08-24
GenBank Submission: KX802301
> BS26378.complete
GAAGTTATCAGTCGACATGTCCCCTGGCCACTTAATCCTGCTGCAGTTCA
GCATGCACTGTTTCAAGATCATTTTCATCTATTGCATCTGTGTTAATGTC
CTGGAGCATCTTGTTCAAAGCGTCCAGGAACACTGAAAGCTTTCTAGACC
AT
BS26378.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42781-RA | 120 | CG42781-PA | 1..120 | 17..136 | 600 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42781-RA | 258 | CG42781-RA | 83..204 | 16..137 | 610 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:46:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7382787..7382908 | 137..16 | 610 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 21:46:55 has no hits.
BS26378.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:24 Download gff for
BS26378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 1..119 | 17..135 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:36:29 Download gff for
BS26378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 50..168 | 17..135 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:05 Download gff for
BS26378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 84..202 | 17..135 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:05 Download gff for
BS26378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7382789..7382907 | 17..135 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:36:29 Download gff for
BS26378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7276822..7276940 | 17..135 | 100 | | Minus |
BS26378.pep Sequence
Translation from 16 to 135
> BS26378.pep
MSPGHLILLQFSMHCFKIIFIYCICVNVLEHLVQSVQEH*
BS26378.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42781-PA | 39 | CG42781-PA | 1..39 | 1..39 | 211 | 100 | Plus |