BS26382.complete Sequence
197 bp assembled on 2011-09-14
GenBank Submission: KX803407
> BS26382.complete
GAAGTTATCAGTCGACATGCGGTTGATTTTTTTCTGCTTGTGCCTCTTTT
TGTCCCTGGAGCTAGTAGTGCCCAGACATGTCGTGGGCCACGATGGATAC
CACAACATCGAGAAGGAAAAGCGCTGGAAAAACTGGCCAGCACGTGTGAG
GCACCACCATAAACAACGTAACTCCATCTGAAAGCTTTCTAGACCAT
BS26382.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:31:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42866-RA | 165 | CG42866-PA | 1..165 | 17..181 | 825 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:31:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42866-RA | 403 | CG42866-RA | 24..188 | 17..181 | 825 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:31:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19961439..19961580 | 181..40 | 710 | 100 | Minus |
Blast to na_te.dros performed 2014-11-27 07:31:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbuz\Osvaldo | 9045 | Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). | 3002..3041 | 124..165 | 115 | 78.6 | Plus |
BS26382.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:41 Download gff for
BS26382.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42866-RA | 1..164 | 17..180 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:16:58 Download gff for
BS26382.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42866-RA | 24..187 | 17..180 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:16 Download gff for
BS26382.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42866-RA | 24..187 | 17..180 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:16 Download gff for
BS26382.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19961639..19961662 | 17..40 | 100 | | Minus |
2L | 19961440..19961579 | 41..180 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:16:58 Download gff for
BS26382.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19961440..19961579 | 41..180 | 100 | <- | Minus |
arm_2L | 19961639..19961662 | 17..40 | 100 | | Minus |
BS26382.pep Sequence
Translation from 16 to 180
> BS26382.pep
MRLIFFCLCLFLSLELVVPRHVVGHDGYHNIEKEKRWKNWPARVRHHHKQ
RNSI*
BS26382.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:18:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42866-PA | 54 | CG42866-PA | 1..54 | 1..54 | 306 | 100 | Plus |