Clone BS26382 Report

Search the DGRC for BS26382

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCG42866-RA
Protein status:BS26382.pep: gold
Sequenced Size:197

Clone Sequence Records

BS26382.complete Sequence

197 bp assembled on 2011-09-14

GenBank Submission: KX803407

> BS26382.complete
GAAGTTATCAGTCGACATGCGGTTGATTTTTTTCTGCTTGTGCCTCTTTT
TGTCCCTGGAGCTAGTAGTGCCCAGACATGTCGTGGGCCACGATGGATAC
CACAACATCGAGAAGGAAAAGCGCTGGAAAAACTGGCCAGCACGTGTGAG
GCACCACCATAAACAACGTAACTCCATCTGAAAGCTTTCTAGACCAT

BS26382.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42866-RA 165 CG42866-PA 1..165 17..181 825 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42866-RA 403 CG42866-RA 24..188 17..181 825 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19961439..19961580 181..40 710 100 Minus
Blast to na_te.dros performed 2014-11-27 07:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 3002..3041 124..165 115 78.6 Plus

BS26382.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:41 Download gff for BS26382.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 1..164 17..180 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:16:58 Download gff for BS26382.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 24..187 17..180 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:16 Download gff for BS26382.complete
Subject Subject Range Query Range Percent Splice Strand
CG42866-RA 24..187 17..180 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:16 Download gff for BS26382.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19961639..19961662 17..40 100   Minus
2L 19961440..19961579 41..180 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:16:58 Download gff for BS26382.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19961440..19961579 41..180 100 <- Minus
arm_2L 19961639..19961662 17..40 100   Minus

BS26382.pep Sequence

Translation from 16 to 180

> BS26382.pep
MRLIFFCLCLFLSLELVVPRHVVGHDGYHNIEKEKRWKNWPARVRHHHKQ
RNSI*

BS26382.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG42866-PA 54 CG42866-PA 1..54 1..54 306 100 Plus