Clone BS26384 Report

Search the DGRC for BS26384

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptCG42870-RA
Protein status:BS26384.pep: full length peptide match
Sequenced Size:281

Clone Sequence Records

BS26384.complete Sequence

281 bp assembled on 2011-08-24

GenBank Submission: KX803947

> BS26384.complete
GAAGTTATCAGTCGACATGCTTTTGGGCATGGCCATCGCTTTTCCCACTC
ATCAGTTCGTGCCACACATACCTTATGGCATGGATGACTTTTACCCGTTT
CTTGCCAGAAATTCCACCGATGTGCTGCCGTTGTCTACAAATCTAACTCA
AATTGAACGACTAGGATGGGCCGATAAATGTGTGCAGTTTAGAAATAAGT
GCACATTAGCAGAGCATTGTTGCAGTCTTAGATGCCTGAAACGTATTTAT
CGATGCATTACCTAAAAGCTTTCTAGACCAT

BS26384.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-RB 285 CG42870-PB 37..285 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-RB 368 CG42870-RB 45..293 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21737186..21737320 151..17 675 100 Minus
3R 32079331 3R 21737008..21737121 265..152 570 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:45:31 has no hits.

BS26384.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:22 Download gff for BS26384.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RA 11..257 17..263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:35:49 Download gff for BS26384.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RB 45..291 17..263 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:41:36 Download gff for BS26384.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RB 45..291 17..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:41:36 Download gff for BS26384.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21737186..21737320 17..151 100   Minus
3R 21737010..21737121 152..263 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:35:49 Download gff for BS26384.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17562732..17562843 152..263 100 <- Minus
arm_3R 17562908..17563042 17..151 100   Minus

BS26384.pep Sequence

Translation from 16 to 264

> BS26384.pep
MLLGMAIAFPTHQFVPHIPYGMDDFYPFLARNSTDVLPLSTNLTQIERLG
WADKCVQFRNKCTLAEHCCSLRCLKRIYRCIT*

BS26384.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-PB 94 CG42870-PB 13..94 1..82 454 100 Plus