BS26385.complete Sequence
185 bp assembled on 2011-08-24
GenBank Submission: KX804169
> BS26385.complete
GAAGTTATCAGTCGACATGTGCTGCAATCCTGGAGGCTGCTGCAACCTGC
CCTCCTGCATCCAGTGCACCAACTTTTGTTTCAACTGCTGGACGGGAACT
GCTGCAGTGCCATGTTGCCGAGGTAGTTGCATTCCGGGATGCAGTAGCAG
CCCTGGATGCCGTTGCTGAAAGCTTTCTAGACCAT
BS26385.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42688-RB | 153 | CG42688-PB | 1..153 | 17..169 | 765 | 100 | Plus |
CG42688-RA | 153 | CG42688-PA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42688-RB | 785 | CG42688-RB | 345..497 | 17..169 | 765 | 100 | Plus |
CG42688-RA | 397 | CG42688-RA | 183..335 | 17..169 | 765 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:48:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19182253..19182405 | 169..17 | 765 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 21:48:02 has no hits.
BS26385.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:26 Download gff for
BS26385.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42688-RA | 194..345 | 17..168 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:37:06 Download gff for
BS26385.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42688-RA | 183..334 | 17..168 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:35 Download gff for
BS26385.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42688-RA | 183..334 | 17..168 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:35 Download gff for
BS26385.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19182254..19182405 | 17..168 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:37:06 Download gff for
BS26385.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19182254..19182405 | 17..168 | 100 | | Minus |
BS26385.pep Sequence
Translation from 16 to 168
> BS26385.pep
MCCNPGGCCNLPSCIQCTNFCFNCWTGTAAVPCCRGSCIPGCSSSPGCRC
*
BS26385.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42688-PB | 50 | CG42688-PB | 1..50 | 1..50 | 323 | 100 | Plus |
CG42688-PA | 50 | CG42688-PA | 1..50 | 1..50 | 323 | 100 | Plus |