Clone BS26385 Report

Search the DGRC for BS26385

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG42688-RA
Protein status:BS26385.pep: full length peptide match
Sequenced Size:185

Clone Sequence Records

BS26385.complete Sequence

185 bp assembled on 2011-08-24

GenBank Submission: KX804169

> BS26385.complete
GAAGTTATCAGTCGACATGTGCTGCAATCCTGGAGGCTGCTGCAACCTGC
CCTCCTGCATCCAGTGCACCAACTTTTGTTTCAACTGCTGGACGGGAACT
GCTGCAGTGCCATGTTGCCGAGGTAGTTGCATTCCGGGATGCAGTAGCAG
CCCTGGATGCCGTTGCTGAAAGCTTTCTAGACCAT

BS26385.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-RB 153 CG42688-PB 1..153 17..169 765 100 Plus
CG42688-RA 153 CG42688-PA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-RB 785 CG42688-RB 345..497 17..169 765 100 Plus
CG42688-RA 397 CG42688-RA 183..335 17..169 765 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19182253..19182405 169..17 765 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:48:02 has no hits.

BS26385.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:26 Download gff for BS26385.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 194..345 17..168 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:37:06 Download gff for BS26385.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 183..334 17..168 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:35 Download gff for BS26385.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 183..334 17..168 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:35 Download gff for BS26385.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19182254..19182405 17..168 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:37:06 Download gff for BS26385.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19182254..19182405 17..168 100   Minus

BS26385.pep Sequence

Translation from 16 to 168

> BS26385.pep
MCCNPGGCCNLPSCIQCTNFCFNCWTGTAAVPCCRGSCIPGCSSSPGCRC
*

BS26385.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-PB 50 CG42688-PB 1..50 1..50 323 100 Plus
CG42688-PA 50 CG42688-PA 1..50 1..50 323 100 Plus