BS26386.complete Sequence
236 bp assembled on 2011-08-24
GenBank Submission: KX800187
> BS26386.complete
GAAGTTATCAGTCGACATGAAAAGATGCAGCCGTATAAATCGCACTGGAA
TTGAGCGATCGCAGTTATTGACTCGTCTCAATTGTCGCAGCGATGAAGTG
GTTTTCGATTTTGTTTGCGCTACTGGCGCTCATTTTCTTCGTCGAATTTG
GATATGCTCGAACAATTCCCAGGATTACCATTCGCAATGGCGACATTATA
GTTCATGGCAATTGCAATGAAAGCTTTCTAGACCAT
BS26386.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:20
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43202-RA | 192 | CG43202-PA | 1..128 | 93..220 | 640 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:21
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43202-RA | 390 | CG43202-RA | 1..209 | 12..220 | 1030 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:48:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 18381696..18381845 | 160..11 | 735 | 99.3 | Minus |
| 2R | 25286936 | 2R | 18381574..18381634 | 220..160 | 305 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 21:48:19 has no hits.
BS26386.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:27 Download gff for
BS26386.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42737-RA | 6..208 | 17..219 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:37:13 Download gff for
BS26386.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43202-RA | 6..208 | 17..219 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:41 Download gff for
BS26386.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43202-RA | 6..208 | 17..219 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:41 Download gff for
BS26386.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 18381575..18381634 | 160..219 | 100 | <- | Minus |
| 2R | 18381697..18381839 | 17..159 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:37:13 Download gff for
BS26386.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 14269080..14269139 | 160..219 | 100 | <- | Minus |
| arm_2R | 14269202..14269344 | 17..159 | 100 | | Minus |
BS26386.pep Sequence
Translation from 16 to 219
> BS26386.pep
MKRCSRINRTGIERSQLLTRLNCRSDEVVFDFVCATGAHFLRRIWICSNN
SQDYHSQWRHYSSWQLQ*
Sequence BS26386.pep has no blast hits.
