BS26390.complete Sequence
170 bp assembled on 2011-08-24
GenBank Submission: KX805294
> BS26390.complete
GAAGTTATCAGTCGACATGTTTCGCACACTGTCCATTGAGCCGATTAGAA
TTGAGGAGCGCTCCAAAGATGAGGTCCGTGCTAATATATTAGTGTTCGCT
GTCACCTGTGCCCTTATCCGCTTTATTCCGATAATAGTGAGGAAATTATC
GTAGAAGCTTTCTAGACCAT
BS26390.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34173-RA | 138 | CG34173-PA | 1..138 | 17..154 | 690 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34173-RA | 415 | CG34173-RA | 137..274 | 17..154 | 690 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:49:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 22053975..22054120 | 154..9 | 700 | 98.6 | Minus |
Blast to na_te.dros performed on 2014-11-26 21:49:09 has no hits.
BS26390.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:31 Download gff for
BS26390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 86..217 | 23..154 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:37:39 Download gff for
BS26390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 143..274 | 23..154 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:04 Download gff for
BS26390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34173-RA | 143..274 | 23..154 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:04 Download gff for
BS26390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 22053975..22054106 | 23..154 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:37:39 Download gff for
BS26390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 22053975..22054106 | 23..154 | 100 | | Minus |
BS26390.pep Sequence
Translation from 16 to 153
> BS26390.pep
MFRTLSIEPIRIEERSKDEVRANILVFAVTCALIRFIPIIVRKLS*
BS26390.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34173-PA | 45 | CG34173-PA | 1..45 | 1..45 | 216 | 100 | Plus |