Clone BS26390 Report

Search the DGRC for BS26390

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG34173-RA
Protein status:BS26390.pep: full length peptide match
Sequenced Size:170

Clone Sequence Records

BS26390.complete Sequence

170 bp assembled on 2011-08-24

GenBank Submission: KX805294

> BS26390.complete
GAAGTTATCAGTCGACATGTTTCGCACACTGTCCATTGAGCCGATTAGAA
TTGAGGAGCGCTCCAAAGATGAGGTCCGTGCTAATATATTAGTGTTCGCT
GTCACCTGTGCCCTTATCCGCTTTATTCCGATAATAGTGAGGAAATTATC
GTAGAAGCTTTCTAGACCAT

BS26390.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34173-RA 138 CG34173-PA 1..138 17..154 690 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34173-RA 415 CG34173-RA 137..274 17..154 690 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22053975..22054120 154..9 700 98.6 Minus
Blast to na_te.dros performed on 2014-11-26 21:49:09 has no hits.

BS26390.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:31 Download gff for BS26390.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 86..217 23..154 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:37:39 Download gff for BS26390.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 143..274 23..154 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:04 Download gff for BS26390.complete
Subject Subject Range Query Range Percent Splice Strand
CG34173-RA 143..274 23..154 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:04 Download gff for BS26390.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22053975..22054106 23..154 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:37:39 Download gff for BS26390.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22053975..22054106 23..154 100   Minus

BS26390.pep Sequence

Translation from 16 to 153

> BS26390.pep
MFRTLSIEPIRIEERSKDEVRANILVFAVTCALIRFIPIIVRKLS*

BS26390.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34173-PA 45 CG34173-PA 1..45 1..45 216 100 Plus