Clone BS26391 Report

Search the DGRC for BS26391

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptCG42661-RA
Protein status:BS26391.pep: full length peptide match
Sequenced Size:458

Clone Sequence Records

BS26391.complete Sequence

458 bp assembled on 2011-08-24

GenBank Submission: KX806453

> BS26391.complete
GAAGTTATCAGTCGACATGTGCTTTTGTCCGACACTTGGTCTCAAAATTG
TACTTTTGTTAGTAATACCTATAACCGCAGGAATTAATGGTGCTCAAATA
GCCAAAGATGTTTCTATATTGAATTTATTAAAGGGATACCATTATATTAT
GCTTATTATAAGCCTATCCCTGTCCGTAGTTATACTGGCGACTCTGGTTC
TTTTAATATATGCGGCGATCTGTAATAAAATTCGAATTCTGAAAGTGATG
ATCTTTGTTTATGTAGCCATCGTCGTGGTGAAACTGATAATTCTGTTCGT
GTGTCTAAGTACTGAATTGAATCCTGACAAGACGACAGCCCATCCCATAT
TTATGATATGCTGGCTCCTTACGTTCTTATGTATGGCCGTTATAATAATA
TACTGGCTTCGGCTACATGACCTTGCCAACGAAGACAATTAGAAGCTTTC
TAGACCAT

BS26391.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RB 426 CG42661-PB 1..426 17..442 2130 100 Plus
CG42661-RA 426 CG42661-PA 1..426 17..442 2130 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RB 2597 CG42661-RB 536..962 17..443 2135 100 Plus
CG42661-RA 2531 CG42661-RA 536..962 17..443 2135 100 Plus
CG42660-RB 2597 CG42660-RB 536..962 17..443 2135 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7466401..7466568 80..247 840 100 Plus
3L 28110227 3L 7466625..7466751 247..373 635 100 Plus
3L 28110227 3L 7466818..7466888 373..443 355 100 Plus
3L 28110227 3L 7466286..7466349 17..80 320 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:49:29 has no hits.

BS26391.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:31 Download gff for BS26391.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RD 536..961 17..442 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:37:53 Download gff for BS26391.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RA 536..961 17..442 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:14 Download gff for BS26391.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RB 536..961 17..442 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:14 Download gff for BS26391.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7466286..7466348 17..79 100 -> Plus
3L 7466401..7466568 80..247 100 -> Plus
3L 7466626..7466751 248..373 100 -> Plus
3L 7466819..7466887 374..442 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:37:53 Download gff for BS26391.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7459726..7459851 248..373 100 -> Plus
arm_3L 7459919..7459987 374..442 100   Plus
arm_3L 7459386..7459448 17..79 100 -> Plus
arm_3L 7459501..7459668 80..247 100 -> Plus

BS26391.pep Sequence

Translation from 16 to 441

> BS26391.pep
MCFCPTLGLKIVLLLVIPITAGINGAQIAKDVSILNLLKGYHYIMLIISL
SLSVVILATLVLLIYAAICNKIRILKVMIFVYVAIVVVKLIILFVCLSTE
LNPDKTTAHPIFMICWLLTFLCMAVIIIYWLRLHDLANEDN*

BS26391.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-PB 141 CG42661-PB 1..141 1..141 709 100 Plus
CG42661-PA 141 CG42661-PA 1..141 1..141 709 100 Plus
CG42660-PB 142 CG42660-PB 1..134 1..133 283 45.5 Plus
CG42660-PA 142 CG42660-PA 1..134 1..133 283 45.5 Plus
CG43292-PA 142 CG43292-PA 1..133 1..135 147 28.1 Plus