Clone BS26393 Report

Search the DGRC for BS26393

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG43061-RA
Protein status:BS26393.pep: gold
Sequenced Size:194

Clone Sequence Records

BS26393.complete Sequence

194 bp assembled on 2011-08-24

GenBank Submission: KX801343

> BS26393.complete
GAAGTTATCAGTCGACATGTTGATTGCCCGACTTGGATTCTTGTTGTGCT
CATTGGGCCTTGCAACTGCCATATGTCAAACGAATGGGGAAAGTTGTAAG
TCGCATGCGGATTGCTGCTCCACGATGTGCCTGACCCAACTGGGTCAGTG
TTCACCCAAAAGGGGAGATCAGTGGTAAAAGCTTTCTAGACCAT

BS26393.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG43061-RA 162 CG43061-PA 1..162 17..178 810 100 Plus
Sfp93F-RA 162 CG42608-PA 1..162 17..178 780 98.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG43061-RA 329 CG43061-RA 30..191 17..178 810 100 Plus
Sfp93F-RA 329 CG42608-RA 30..191 17..178 780 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8049838..8049921 95..178 420 100 Plus
3R 32079331 3R 21736047..21736130 178..95 420 100 Minus
3R 32079331 3R 8049702..8049779 17..94 390 100 Plus
3R 32079331 3R 21736190..21736267 94..17 360 97.4 Minus
Blast to na_te.dros performed on 2014-11-26 21:49:42 has no hits.

BS26393.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:32 Download gff for BS26393.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 35..189 22..176 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:38:00 Download gff for BS26393.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 35..189 22..176 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:22 Download gff for BS26393.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 35..189 22..176 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:22 Download gff for BS26393.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21736049..21736130 95..176 100 <- Minus
3R 21736190..21736262 22..94 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:38:00 Download gff for BS26393.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17561771..17561852 95..176 100 <- Minus
arm_3R 17561912..17561984 22..94 97   Minus

BS26393.pep Sequence

Translation from 16 to 177

> BS26393.pep
MLIARLGFLLCSLGLATAICQTNGESCKSHADCCSTMCLTQLGQCSPKRG
DQW*

BS26393.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG43061-PA 53 CG43061-PA 1..53 1..53 294 100 Plus
Sfp93F-PA 53 CG42608-PA 1..53 1..53 285 96.2 Plus