BS26395.complete Sequence
311 bp assembled on 2011-09-14
GenBank Submission: KX802417
> BS26395.complete
GAAGTTATCAGTCGACATGTACAGGAAATTAGTGGTGCTCCTCCTTCTGA
TCCACCTGGCGGCCGCGGGTCAGATCCAGGATGCTGCCGAGGAGATCGAT
GTGCCGCCTGCCCATCGGGCTGCTCCACCACCGCCCCGCCAGGCAGCTGG
AGCTGCTGTTCCCCCACCACCACTGGGGCCACCACCACTTGTGGGCTCTG
CACCGCCGCCGAGCTATCCTTTGTTCTACCCAGCTGCGTGGCTGCCATTC
GGACGCTACAGCAACTCCATTCCCGTCCACATAGTGGCTGCCTAGAAGCT
TTCTAGACCAT
BS26395.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:31:26
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34248-RB | 279 | CG34248-PB | 1..279 | 17..295 | 1395 | 100 | Plus |
| CG34248-RA | 297 | CG34248-PA | 34..297 | 32..295 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:31:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34248-RB | 452 | CG34248-RB | 41..319 | 17..295 | 1395 | 100 | Plus |
| CG34248-RA | 533 | CG34248-RA | 138..401 | 32..295 | 1320 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:31:23
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 16270502..16270765 | 295..32 | 1320 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:31:25 has no hits.
BS26395.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:42 Download gff for
BS26395.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34248-RB | 41..319 | 17..295 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:05 Download gff for
BS26395.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34248-RB | 41..319 | 17..295 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:23 Download gff for
BS26395.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34248-RB | 41..319 | 17..295 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:23 Download gff for
BS26395.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 16270502..16270765 | 32..295 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:05 Download gff for
BS26395.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 16263602..16263865 | 32..295 | 100 | <- | Minus |
BS26395.pep Sequence
Translation from 16 to 294
> BS26395.pep
MYRKLVVLLLLIHLAAAGQIQDAAEEIDVPPAHRAAPPPPRQAAGAAVPP
PPLGPPPLVGSAPPPSYPLFYPAAWLPFGRYSNSIPVHIVAA*
BS26395.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:48:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dana\GF10306-PA | 91 | GF10306-PA | 1..89 | 1..92 | 213 | 71.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:48:06
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dere\GG13480-PA | 98 | GG13480-PA | 12..98 | 6..92 | 252 | 89.7 | Plus |
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:48:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34248-PB | 92 | CG34248-PB | 1..92 | 1..92 | 490 | 100 | Plus |
| CG34248-PA | 98 | CG34248-PA | 12..98 | 6..92 | 464 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:48:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM24429-PA | 98 | GM24429-PA | 24..98 | 18..92 | 198 | 97.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:48:12
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsim\GD12498-PA | 98 | GD12498-PA | 24..98 | 18..92 | 202 | 97.3 | Plus |
