BS26433.complete Sequence
392 bp assembled on 2011-08-24
GenBank Submission: KX801515
> BS26433.complete
GAAGTTATCAGTCGACATGGGCTGTTCTCCGAGTACTTTGCCCCCCGCCC
CTTCCGCTGGTCAGACCGGCGAACGAGGATCCCTGCCGCTGGACGCCTCT
GAAAAGGACGAGAGCCGCCTCTTCTGCATCAAGCTGCGGCGCAGCCGCCT
GCGCCGCTGCAGCTGTGGGGGCGTGACCTTGCAGCCCCCCAGCGACGGGA
ATGGCAGCACGGCCGGAGACAACCTGTGCGGCCAGGTGCTCCTCAATCCG
CTGCAGACCAAGAGCGAGGCCGACTACGAAAAGCTGAGCACCGGCAAAAA
GGACTCGATTGTGACGGTGGCCGCCCTGGGCAACTTTACACACAGCGTAG
TGCGACGGGCCACTGGAAGTAAGTAGAAGCTTTCTAGACCAT
BS26433.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:50:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pde8-RK | 2745 | CG45019-PK | 1..353 | 17..369 | 1765 | 100 | Plus |
Pde8-RI | 2745 | CG45019-PI | 1..353 | 17..369 | 1765 | 100 | Plus |
Pde8-RN | 2850 | CG45019-PN | 1..353 | 17..369 | 1765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:50:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pde8-RK | 5389 | CG45019-RK | 489..842 | 16..369 | 1770 | 100 | Plus |
Pde8-RI | 5562 | CG45019-RI | 662..1015 | 16..369 | 1770 | 100 | Plus |
Pde8-RN | 3939 | CG45019-RN | 775..1128 | 16..369 | 1770 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:50:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23665620..23665887 | 16..283 | 1340 | 100 | Plus |
2R | 25286936 | 2R | 23665949..23666044 | 282..377 | 480 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 21:50:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\ninja | 6644 | Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). | 2149..2217 | 107..176 | 113 | 64.3 | Plus |
BS26433.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:35 Download gff for
BS26433.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pde8-RF | 638..997 | 17..376 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:38:41 Download gff for
BS26433.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pde8-RN | 776..1133 | 17..376 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:59 Download gff for
BS26433.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pde8-RN | 776..1133 | 17..376 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:59 Download gff for
BS26433.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23665621..23665887 | 17..283 | 100 | -> | Plus |
2R | 23665951..23666043 | 284..376 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:38:41 Download gff for
BS26433.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19553144..19553410 | 17..283 | 100 | -> | Plus |
arm_2R | 19553474..19553566 | 284..376 | 100 | | Plus |
BS26433.pep Sequence
Translation from 16 to 375
> BS26433.pep
MGCSPSTLPPAPSAGQTGERGSLPLDASEKDESRLFCIKLRRSRLRRCSC
GGVTLQPPSDGNGSTAGDNLCGQVLLNPLQTKSEADYEKLSTGKKDSIVT
VAALGNFTHSVVRRATGSK*
BS26433.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:27:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Pde8-PE | 905 | CG45019-PE | 1..118 | 1..118 | 612 | 100 | Plus |
Pde8-PK | 914 | CG45019-PK | 1..118 | 1..118 | 612 | 100 | Plus |
Pde8-PI | 914 | CG45019-PI | 1..118 | 1..118 | 612 | 100 | Plus |
Pde8-PA | 914 | CG45019-PA | 1..118 | 1..118 | 612 | 100 | Plus |
Pde8-PN | 949 | CG45019-PN | 1..118 | 1..118 | 612 | 100 | Plus |