Clone BS26524 Report

Search the DGRC for BS26524

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:265
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptRpS21-RE
Protein status:BS26524.pep: gold
Sequenced Size:278

Clone Sequence Records

BS26524.complete Sequence

278 bp assembled on 2012-04-25

GenBank Submission: KX800383

> BS26524.complete
GAAGTTATCAGTCGACATGGAGAACGACGCCGGTGAGAATGTTGATCTGT
ACGTGCCCCGCAAATGCTCGGCGTCCAACAGGATCATCCACGCCAAGGAT
CACGCCTCCGTGCAGCTGAGCATCGTGGATGTGGACCCCGAGACCGGTCG
CCAGACCGACGGTTCCAAGACCTACGCCATCTGCGGCGAGATCCGTCGCA
TGGGCGAGTCCGACGACTGCATCGTGCGTCTGGCCAAGAAGGACGGCATC
ATTACCAAGTGAAAGCTTTCTAGACCAT

BS26524.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-RE 246 CG2986-PE 1..246 17..262 1230 100 Plus
RpS21-RD 252 CG2986-PD 1..243 17..259 1215 100 Plus
RpS21-RB 252 CG2986-PB 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-RE 494 CG2986-RE 116..361 17..262 1230 100 Plus
RpS21-RD 415 CG2986-RD 99..341 17..259 1215 100 Plus
RpS21-RB 619 CG2986-RB 75..317 17..259 1215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2856376..2856572 66..262 985 100 Plus
2L 23513712 2L 2856256..2856305 17..66 250 100 Plus
Blast to na_te.dros performed on 2014-11-28 12:01:06 has no hits.

BS26524.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-25 15:17:08 Download gff for BS26524.complete
Subject Subject Range Query Range Percent Splice Strand
oho23B-RE 116..360 17..261 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:37:17 Download gff for BS26524.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RE 116..360 17..261 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:55:32 Download gff for BS26524.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RE 116..360 17..261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:55:32 Download gff for BS26524.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2856377..2856571 67..261 100   Plus
2L 2856256..2856305 17..66 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:37:17 Download gff for BS26524.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2856256..2856305 17..66 100 -> Plus
arm_2L 2856377..2856571 67..261 100   Plus

BS26524.pep Sequence

Translation from 16 to 261

> BS26524.pep
MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGS
KTYAICGEIRRMGESDDCIVRLAKKDGIITK*

BS26524.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-PE 81 CG2986-PE 1..81 1..81 420 100 Plus
RpS21-PD 83 CG2986-PD 1..81 1..81 420 100 Plus
RpS21-PB 83 CG2986-PB 1..81 1..81 420 100 Plus
RpS21-PA 83 CG2986-PA 1..81 1..81 420 100 Plus
RpS21-PF 83 CG2986-PF 1..81 1..81 420 100 Plus