BS26524.complete Sequence
278 bp assembled on 2012-04-25
GenBank Submission: KX800383
> BS26524.complete
GAAGTTATCAGTCGACATGGAGAACGACGCCGGTGAGAATGTTGATCTGT
ACGTGCCCCGCAAATGCTCGGCGTCCAACAGGATCATCCACGCCAAGGAT
CACGCCTCCGTGCAGCTGAGCATCGTGGATGTGGACCCCGAGACCGGTCG
CCAGACCGACGGTTCCAAGACCTACGCCATCTGCGGCGAGATCCGTCGCA
TGGGCGAGTCCGACGACTGCATCGTGCGTCTGGCCAAGAAGGACGGCATC
ATTACCAAGTGAAAGCTTTCTAGACCAT
BS26524.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:01:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-RE | 246 | CG2986-PE | 1..246 | 17..262 | 1230 | 100 | Plus |
RpS21-RD | 252 | CG2986-PD | 1..243 | 17..259 | 1215 | 100 | Plus |
RpS21-RB | 252 | CG2986-PB | 1..243 | 17..259 | 1215 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:01:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-RE | 494 | CG2986-RE | 116..361 | 17..262 | 1230 | 100 | Plus |
RpS21-RD | 415 | CG2986-RD | 99..341 | 17..259 | 1215 | 100 | Plus |
RpS21-RB | 619 | CG2986-RB | 75..317 | 17..259 | 1215 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:01:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2856376..2856572 | 66..262 | 985 | 100 | Plus |
2L | 23513712 | 2L | 2856256..2856305 | 17..66 | 250 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 12:01:06 has no hits.
BS26524.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-25 15:17:08 Download gff for
BS26524.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
oho23B-RE | 116..360 | 17..261 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:37:17 Download gff for
BS26524.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS21-RE | 116..360 | 17..261 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:55:32 Download gff for
BS26524.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS21-RE | 116..360 | 17..261 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:55:32 Download gff for
BS26524.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2856377..2856571 | 67..261 | 100 | | Plus |
2L | 2856256..2856305 | 17..66 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:37:17 Download gff for
BS26524.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2856256..2856305 | 17..66 | 100 | -> | Plus |
arm_2L | 2856377..2856571 | 67..261 | 100 | | Plus |
BS26524.pep Sequence
Translation from 16 to 261
> BS26524.pep
MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGS
KTYAICGEIRRMGESDDCIVRLAKKDGIITK*
BS26524.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:22:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-PE | 81 | CG2986-PE | 1..81 | 1..81 | 420 | 100 | Plus |
RpS21-PD | 83 | CG2986-PD | 1..81 | 1..81 | 420 | 100 | Plus |
RpS21-PB | 83 | CG2986-PB | 1..81 | 1..81 | 420 | 100 | Plus |
RpS21-PA | 83 | CG2986-PA | 1..81 | 1..81 | 420 | 100 | Plus |
RpS21-PF | 83 | CG2986-PF | 1..81 | 1..81 | 420 | 100 | Plus |