Clone BS26581 Report

Search the DGRC for BS26581

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:265
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG42508-RA
Protein status:BS26581.pep: full length peptide match
Sequenced Size:374

Clone Sequence Records

BS26581.complete Sequence

374 bp assembled on 2011-08-26

GenBank Submission: KX800570

> BS26581.complete
GAAGTTATCAGTCGACATGGTCGGTCCATTCATGCAGGGCCTATTCTTGA
TTGGCATCATCTACTGGTATTCCAAGGGGATGATGTCCATGATCAACGAC
TACTACAGAAGTGAGTTCCAGCGAAAGTTGCAGACGGAACCAGCAAAGAC
GAGGGCAGAGACACCCATCAATGTGGACAACTTTATGGATTATGTTAGGG
AGCTGGACACTCCGGACGAGGTGGCTAGAATTCCGGCGGAAGGAACTGAA
TCTCCGCCCATGGGAAACACCTATTGCCACATCCTTCGACGATTCTTGGA
GATTACCGGCACTCTACCACCATTCGATGTTTGCCTAGTTACGAGCAACA
TAAGATAGAAGCTTTCTAGACCAT

BS26581.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-RB 342 CG42508-PB 1..342 17..358 1710 100 Plus
CG42508-RA 342 CG42508-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-RB 1029 CG42508-RB 525..866 17..358 1710 100 Plus
CG42508-RA 949 CG42508-RA 521..862 17..358 1710 100 Plus
Xport-RA 949 CG4468-RA 521..862 17..358 1710 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19914483..19914824 358..17 1710 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:26:38 has no hits.

BS26581.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:35 Download gff for BS26581.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 518..859 17..358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:58:15 Download gff for BS26581.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RB 503..844 17..358 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:01:15 Download gff for BS26581.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RA 521..862 17..358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:01:15 Download gff for BS26581.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19914483..19914824 17..358 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:58:15 Download gff for BS26581.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15740205..15740546 17..358 100   Minus

BS26581.pep Sequence

Translation from 16 to 357

> BS26581.pep
MVGPFMQGLFLIGIIYWYSKGMMSMINDYYRSEFQRKLQTEPAKTRAETP
INVDNFMDYVRELDTPDEVARIPAEGTESPPMGNTYCHILRRFLEITGTL
PPFDVCLVTSNIR*

BS26581.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-PB 113 CG42508-PB 1..113 1..113 604 100 Plus
CG42508-PA 113 CG42508-PA 1..113 1..113 604 100 Plus