BS26902.complete Sequence
281 bp assembled on 2011-08-31
GenBank Submission: KX802447
> BS26902.complete
GAAGTTATCAGTCGACATGAGATCGTTTTGTGTGTCTGTCTTATTAGTTA
CCCTTTTGGGGATTGCGATGGCATATAGAGATTATTCGGAGAAGTGCTAT
CAATCCCCTCGGTCTTATGGACCTTGTAATGTTAAGGCCCATGGATACAC
TTATGATTCTCGTAGAAATGTATGTCGTCGAATTGTTCTTCGGTGTATGG
CAAGGGGTAACTATTTCTTTGACAAAGATTCCTGCGAATACACATGCTTA
AAGCATATTCAGTAGAAGCTTTCTAGACCAT
BS26902.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42467-RA | 249 | CG42467-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42467-RA | 361 | CG42467-RA | 18..269 | 17..268 | 1260 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:35:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3701423..3701607 | 84..268 | 925 | 100 | Plus |
2L | 23513712 | 2L | 3701307..3701373 | 17..83 | 335 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 01:35:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 289..352 | 65..3 | 110 | 65.6 | Minus |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 3069..3132 | 65..3 | 110 | 65.6 | Minus |
BS26902.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 16:54:44 Download gff for
BS26902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 1..249 | 17..265 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:32 Download gff for
BS26902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 18..266 | 17..265 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:28:23 Download gff for
BS26902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 18..266 | 17..265 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:28:23 Download gff for
BS26902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3701307..3701373 | 17..83 | 100 | -> | Plus |
2L | 3701423..3701604 | 84..265 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:32 Download gff for
BS26902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3701307..3701373 | 17..83 | 100 | -> | Plus |
arm_2L | 3701423..3701604 | 84..265 | 100 | | Plus |
BS26902.pep Sequence
Translation from 16 to 264
> BS26902.pep
MRSFCVSVLLVTLLGIAMAYRDYSEKCYQSPRSYGPCNVKAHGYTYDSRR
NVCRRIVLRCMARGNYFFDKDSCEYTCLKHIQ*
BS26902.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:05:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42467-PA | 82 | CG42467-PA | 1..82 | 1..82 | 452 | 100 | Plus |
Sfp24C1-PA | 80 | CG42466-PA | 1..78 | 1..81 | 143 | 40.7 | Plus |