Clone BS26902 Report

Search the DGRC for BS26902

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:269
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG42467-RA
Protein status:BS26902.pep: gold
Sequenced Size:281

Clone Sequence Records

BS26902.complete Sequence

281 bp assembled on 2011-08-31

GenBank Submission: KX802447

> BS26902.complete
GAAGTTATCAGTCGACATGAGATCGTTTTGTGTGTCTGTCTTATTAGTTA
CCCTTTTGGGGATTGCGATGGCATATAGAGATTATTCGGAGAAGTGCTAT
CAATCCCCTCGGTCTTATGGACCTTGTAATGTTAAGGCCCATGGATACAC
TTATGATTCTCGTAGAAATGTATGTCGTCGAATTGTTCTTCGGTGTATGG
CAAGGGGTAACTATTTCTTTGACAAAGATTCCTGCGAATACACATGCTTA
AAGCATATTCAGTAGAAGCTTTCTAGACCAT

BS26902.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42467-RA 249 CG42467-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42467-RA 361 CG42467-RA 18..269 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3701423..3701607 84..268 925 100 Plus
2L 23513712 2L 3701307..3701373 17..83 335 100 Plus
Blast to na_te.dros performed 2014-11-27 01:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 289..352 65..3 110 65.6 Minus
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 3069..3132 65..3 110 65.6 Minus

BS26902.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 16:54:44 Download gff for BS26902.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 1..249 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:32 Download gff for BS26902.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 18..266 17..265 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:28:23 Download gff for BS26902.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 18..266 17..265 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:28:23 Download gff for BS26902.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3701307..3701373 17..83 100 -> Plus
2L 3701423..3701604 84..265 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:32 Download gff for BS26902.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3701307..3701373 17..83 100 -> Plus
arm_2L 3701423..3701604 84..265 100   Plus

BS26902.pep Sequence

Translation from 16 to 264

> BS26902.pep
MRSFCVSVLLVTLLGIAMAYRDYSEKCYQSPRSYGPCNVKAHGYTYDSRR
NVCRRIVLRCMARGNYFFDKDSCEYTCLKHIQ*

BS26902.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG42467-PA 82 CG42467-PA 1..82 1..82 452 100 Plus
Sfp24C1-PA 80 CG42466-PA 1..78 1..81 143 40.7 Plus