Clone BS27011 Report

Search the DGRC for BS27011

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:270
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG43084-RA
Protein status:BS27011.pep: gold
Sequenced Size:377

Clone Sequence Records

BS27011.complete Sequence

377 bp assembled on 2011-10-18

GenBank Submission: KX805443

> BS27011.complete
GAAGTTATCAGTCGACATGATCCCAATAAGCTCATCAAAATTAAATAGGA
AACTGGCAAGTAAACCCTTCCTAAATGAAGGACTACCTGCCAGAAAGTCT
ATCGGTTGTCTTTTTCTTGGCATAATACTTGGAGTTTTTTTAGCCGGAAT
ACTCTTTTACTCGCTGATGAACGAAGACTGCCGGAAAAGTTCGAGGAATA
TAATGAGCATTATTGGAGTGGAAATACCTCAAAACAAAAACGCCACATCG
AAATTGGATACTGCCGCAAAAAATGTAGAAGAGAGTAGCGTAGCGGTTAC
ACAAGAAACCCCTGCTGAATTTAATAAAGCTGATAATAATTCAACAGTTT
CAATGCCCTAAAAGCTTTCTAGACCAT

BS27011.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG43084-RA 345 CG43084-PA 1..345 17..361 1725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43084-RA 450 CG43084-RA 40..384 17..361 1725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15651043..15651326 78..361 1420 100 Plus
3L 28110227 3L 15650891..15650955 17..81 325 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:15:31 has no hits.

BS27011.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-18 10:25:24 Download gff for BS27011.complete
Subject Subject Range Query Range Percent Splice Strand
CG43084-RA 1..343 17..359 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:52:04 Download gff for BS27011.complete
Subject Subject Range Query Range Percent Splice Strand
CG43084-RA 40..382 17..359 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:55:43 Download gff for BS27011.complete
Subject Subject Range Query Range Percent Splice Strand
CG43084-RA 40..382 17..359 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:55:43 Download gff for BS27011.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15650891..15650954 17..80 100 -> Plus
3L 15651046..15651324 81..359 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:52:04 Download gff for BS27011.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15643991..15644054 17..80 100 -> Plus
arm_3L 15644146..15644424 81..359 100   Plus

BS27011.pep Sequence

Translation from 16 to 360

> BS27011.pep
MIPISSSKLNRKLASKPFLNEGLPARKSIGCLFLGIILGVFLAGILFYSL
MNEDCRKSSRNIMSIIGVEIPQNKNATSKLDTAAKNVEESSVAVTQETPA
EFNKADNNSTVSMP*

BS27011.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG43084-PA 114 CG43084-PA 1..114 1..114 566 100 Plus