BS27203.complete Sequence
368 bp assembled on 2011-08-31
GenBank Submission: KX800784
> BS27203.complete
GAAGTTATCAGTCGACATGTTCAAATACGCCGTCCTTGTCCTGATAACCG
TCGCCTGCGCTGCTGCCAAGCCCGATCTCCTGGGTGCTGCCCTGGCGTAC
ACTGGTCCTCTGGCTTACTCTGCTCCTCTAGACTACTCTGCTCTCGCTGC
CGTGGTAACTGCTCCCACTCCACCTGTGACCGCCACCAGTATCGCCAGGA
ACAACAATGGAATCGATGCTGCTTCTGAGATTGCTTCCGTTGCTGCTCCA
GTGGTGGCCAAGTACGCTGCTGCTTCTTTGGCCTACCCTTCGCGTTTGGC
CAACTCCGCTCCAATCAGCTGCGCCTCTGCTGCTGCGCAGGTCATCATCT
AAAAGCTTTCTAGACCAT
BS27203.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG32212-RA | 336 | CG32212-PA | 1..336 | 17..352 | 1680 | 100 | Plus |
| CG14096-RA | 369 | CG14096-PA | 1..305 | 17..312 | 695 | 82.6 | Plus |
| CG18294-RA | 426 | CG18294-PA | 1..276 | 17..283 | 640 | 83 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG32212-RA | 730 | CG32212-RA | 394..730 | 16..352 | 1685 | 100 | Plus |
| CG14096-RA | 458 | CG14096-RA | 51..355 | 17..312 | 695 | 82.6 | Plus |
| CG18294-RA | 507 | CG18294-RA | 55..330 | 17..283 | 640 | 83 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:36:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 19488025..19488349 | 29..353 | 1625 | 100 | Plus |
| 3L | 28110227 | 3L | 19478353..19478571 | 29..238 | 715 | 89.5 | Plus |
| 3L | 28110227 | 3L | 19423829..19424047 | 29..238 | 700 | 89 | Plus |
| 3L | 28110227 | 3L | 19466670..19466942 | 312..49 | 670 | 83.9 | Minus |
| 3L | 28110227 | 3L | 19475194..19475437 | 283..49 | 615 | 84.4 | Minus |
| 3L | 28110227 | 3L | 19472630..19472872 | 49..282 | 610 | 84.4 | Plus |
| 3L | 28110227 | 3L | 19424047..19424124 | 276..353 | 360 | 97.4 | Plus |
| 3L | 28110227 | 3L | 19478571..19478648 | 276..353 | 360 | 97.4 | Plus |
| 3L | 28110227 | 3L | 19467530..19467682 | 106..249 | 295 | 81 | Plus |
| 3L | 28110227 | 3L | 19471895..19472047 | 249..106 | 295 | 81 | Minus |
| 3L | 28110227 | 3L | 19476020..19476172 | 106..249 | 280 | 80.4 | Plus |
| 3L | 28110227 | 3L | 19475981..19476059 | 49..127 | 275 | 89.9 | Plus |
| 3L | 28110227 | 3L | 19467491..19467569 | 49..127 | 275 | 89.9 | Plus |
| 3L | 28110227 | 3L | 19472008..19472086 | 127..49 | 275 | 89.9 | Minus |
| 3L | 28110227 | 3L | 19424825..19424869 | 242..286 | 195 | 95.6 | Plus |
Blast to na_te.dros performed 2014-11-27 01:36:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2757..2819 | 278..213 | 142 | 72.7 | Minus |
BS27203.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 16:54:51 Download gff for
BS27203.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG32212-RA | 6..334 | 22..350 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:59 Download gff for
BS27203.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG32212-RA | 190..518 | 22..350 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:28:47 Download gff for
BS27203.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG32212-RA | 400..728 | 22..350 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:28:47 Download gff for
BS27203.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 19488018..19488346 | 22..350 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:59 Download gff for
BS27203.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 19481118..19481446 | 22..350 | 98 | | Plus |
BS27203.pep Sequence
Translation from 16 to 351
> BS27203.pep
MFKYAVLVLITVACAAAKPDLLGAALAYTGPLAYSAPLDYSALAAVVTAP
TPPVTATSIARNNNGIDAASEIASVAAPVVAKYAAASLAYPSRLANSAPI
SCASAAAQVII*
BS27203.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:05:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG32212-PA | 111 | CG32212-PA | 1..111 | 1..111 | 535 | 100 | Plus |
| CG14096-PA | 122 | CG14096-PA | 1..110 | 1..107 | 325 | 69.1 | Plus |
| CG12519-PB | 131 | CG12519-PB | 1..131 | 1..111 | 318 | 61.8 | Plus |
| CG12519-PA | 131 | CG12519-PA | 1..131 | 1..111 | 318 | 61.8 | Plus |
| CG18294-PA | 141 | CG18294-PA | 1..115 | 1..107 | 307 | 66.1 | Plus |
