BS27204.complete Sequence
281 bp assembled on 2011-09-14
GenBank Submission: KX804457
> BS27204.complete
GAAGTTATCAGTCGACATGAGCGATGCCTCCCTGGAACTTCCCTCTGAAC
TATTGAACAAATCTCTAGTGACGGTCACCAATATCTCAAAGTCGTTGTCT
CGCCTGATTTTGAACTCCGCTCGCCGCTACTCCCGCTTCGTGCTCTTCTT
TAAGCCAGTTTTCGGAGATGCCCTGGTGGTCAAGGGATCTGAAGATCCCA
CTACAACCACCACAGTACGCACCACCACAACCACCGAAGAGACTGACAAG
CTCAACGAAGTCTAAAAGCTTTCTAGACCAT
BS27204.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:34:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43386-RB | 462 | CG43386-PB | 213..462 | 16..265 | 1235 | 99.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:34:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43386-RB | 716 | CG43386-RB | 371..621 | 16..266 | 1240 | 99.6 | Plus |
| CG1889-RA | 1468 | CG1889-RA | 1219..1373 | 266..112 | 760 | 99.4 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:33:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 9966710..9966864 | 266..112 | 760 | 99.4 | Minus |
| X | 23542271 | X | 9967024..9967120 | 112..16 | 485 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:34:01 has no hits.
BS27204.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:47 Download gff for
BS27204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15250-RA | 1..247 | 17..263 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:59 Download gff for
BS27204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43386-RB | 372..618 | 17..263 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:13:05 Download gff for
BS27204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43386-RB | 372..618 | 17..263 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:13:05 Download gff for
BS27204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 9967024..9967119 | 17..112 | 100 | | Minus |
| X | 9966713..9966863 | 113..263 | 99 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:59 Download gff for
BS27204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 9861057..9861152 | 17..112 | 100 | | Minus |
| arm_X | 9860746..9860896 | 113..263 | 99 | <- | Minus |
BS27204.pep Sequence
Translation from 16 to 264
> BS27204.pep
MSDASLELPSELLNKSLVTVTNISKSLSRLILNSARRYSRFVLFFKPVFG
DALVVKGSEDPTTTTTVRTTTTTEETDKLNEV*
BS27204.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:18:47
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43386-PB | 153 | CG15250-PA | 72..153 | 1..82 | 398 | 100 | Plus |
