Clone BS27315 Report

Search the DGRC for BS27315

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:273
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG32856-RA
Protein status:BS27315.pep: gold
Sequenced Size:356

Clone Sequence Records

BS27315.complete Sequence

356 bp assembled on 2011-09-07

GenBank Submission: KX800373

> BS27315.complete
GAAGTTATCAGTCGACATGCTGCAAACAAATCGAGTCCTTCAAAAAGAGC
AGGCTGAACTATTTGCTATCCAGAAGAAACTCGACCGAGTGCTCCCCGTC
ATTCAGGAGGCATTAAATTCACTAAAGGTAGAGGAGCTGCATCTCAAGTC
TCAGGTGGTGGGCCAGCAGAACCCAAAAACGCAGTGCTCCCCTGGAAGGG
ATCCCCTCCACATAGATCTGTCGGTGGAGCAGTCCCCAATCACAACTGTG
ATGGAGTCCCATCTCGTCAACAGCCAGCAAATAGATCTGGATCTCGTAAG
CCAAATGAGGCGTTTCGAGGAGGAAGTCGACTCGGATTAAAAGCTTTCTA
GACCAT

BS27315.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-RB 324 CG32856-PB 1..324 17..340 1620 100 Plus
CG32856-RA 324 CG32856-PA 1..324 17..340 1620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-RB 620 CG32856-RB 168..493 17..342 1630 100 Plus
CG32856-RA 563 CG32856-RA 168..493 17..342 1630 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15964805..15965021 342..126 1085 100 Minus
3R 32079331 3R 15965071..15965184 130..17 570 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:50:17 has no hits.

BS27315.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:25 Download gff for BS27315.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RB 168..489 17..338 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:04 Download gff for BS27315.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 168..489 17..338 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:32:45 Download gff for BS27315.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 168..489 17..338 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:32:45 Download gff for BS27315.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15964809..15965019 128..338 100 <- Minus
3R 15965074..15965184 17..127 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:04 Download gff for BS27315.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11790531..11790741 128..338 100 <- Minus
arm_3R 11790796..11790906 17..127 100   Minus

BS27315.pep Sequence

Translation from 16 to 339

> BS27315.pep
MLQTNRVLQKEQAELFAIQKKLDRVLPVIQEALNSLKVEELHLKSQVVGQ
QNPKTQCSPGRDPLHIDLSVEQSPITTVMESHLVNSQQIDLDLVSQMRRF
EEEVDSD*

BS27315.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-PB 107 CG32856-PB 1..107 1..107 531 100 Plus
CG32856-PA 107 CG32856-PA 1..107 1..107 531 100 Plus