Clone BS27319 Report

Search the DGRC for BS27319

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:273
Well:19
Vector:pDNR-Dual
Associated Gene/Transcriptmsopa-RA
Protein status:BS27319.pep: gold
Sequenced Size:284

Clone Sequence Records

BS27319.complete Sequence

284 bp assembled on 2011-09-07

GenBank Submission: KX802625

> BS27319.complete
GAAGTTATCAGTCGACATGAACTTCATACAGATCGCCGTGCTGTTCGTCC
TGGTCGCAGTGGCCTTGGCCAGACCACAGGAAGATCCGGCAAATCTGCCA
GCTCCAGAGGCAGCAGCAGCACCACCAGCAGCAGCAGCAGCACCACCAGC
AGCAGCAGCAGCACCACCAGCACCACCAGCACCACCAGCTGCAGCACCTC
AAGCCGCTCCAGCGGGTGGTTCCGGTAGAAAGAAAAATGTCAATCACAAC
GTCATAACCATTGGATAAAAGCTTTCTAGACCAT

BS27319.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
msopa-RB 252 CG14560-PB 1..252 17..268 1260 100 Plus
msopa-RA 252 CG14560-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
msopa-RB 648 CG14560-RB 109..367 12..270 1280 99.6 Plus
msopa-RA 377 CG14560-RA 21..279 12..270 1280 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:51:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22082828..22083086 12..270 1280 99.6 Plus
Blast to na_te.dros performed on 2014-11-27 01:51:14 has no hits.

BS27319.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:27 Download gff for BS27319.complete
Subject Subject Range Query Range Percent Splice Strand
msopa-RA 26..275 17..266 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:28 Download gff for BS27319.complete
Subject Subject Range Query Range Percent Splice Strand
msopa-RA 26..275 17..266 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:33:03 Download gff for BS27319.complete
Subject Subject Range Query Range Percent Splice Strand
msopa-RA 26..275 17..266 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:33:03 Download gff for BS27319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22082833..22083082 17..266 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:28 Download gff for BS27319.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22075933..22076182 17..266 100   Plus

BS27319.pep Sequence

Translation from 16 to 267

> BS27319.pep
MNFIQIAVLFVLVAVALARPQEDPANLPAPEAAAAPPAAAAAPPAAAAAP
PAPPAPPAAAPQAAPAGGSGRKKNVNHNVITIG*

BS27319.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
msopa-PB 83 CG14560-PB 1..83 1..83 419 100 Plus
msopa-PA 83 CG14560-PA 1..83 1..83 419 100 Plus