BS27319.complete Sequence
284 bp assembled on 2011-09-07
GenBank Submission: KX802625
> BS27319.complete
GAAGTTATCAGTCGACATGAACTTCATACAGATCGCCGTGCTGTTCGTCC
TGGTCGCAGTGGCCTTGGCCAGACCACAGGAAGATCCGGCAAATCTGCCA
GCTCCAGAGGCAGCAGCAGCACCACCAGCAGCAGCAGCAGCACCACCAGC
AGCAGCAGCAGCACCACCAGCACCACCAGCACCACCAGCTGCAGCACCTC
AAGCCGCTCCAGCGGGTGGTTCCGGTAGAAAGAAAAATGTCAATCACAAC
GTCATAACCATTGGATAAAAGCTTTCTAGACCAT
BS27319.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:51:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
msopa-RB | 252 | CG14560-PB | 1..252 | 17..268 | 1260 | 100 | Plus |
msopa-RA | 252 | CG14560-PA | 1..252 | 17..268 | 1260 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:51:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
msopa-RB | 648 | CG14560-RB | 109..367 | 12..270 | 1280 | 99.6 | Plus |
msopa-RA | 377 | CG14560-RA | 21..279 | 12..270 | 1280 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:51:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 22082828..22083086 | 12..270 | 1280 | 99.6 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:51:14 has no hits.
BS27319.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:27 Download gff for
BS27319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
msopa-RA | 26..275 | 17..266 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:28 Download gff for
BS27319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
msopa-RA | 26..275 | 17..266 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:33:03 Download gff for
BS27319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
msopa-RA | 26..275 | 17..266 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:33:03 Download gff for
BS27319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22082833..22083082 | 17..266 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:28 Download gff for
BS27319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 22075933..22076182 | 17..266 | 100 | | Plus |
BS27319.pep Sequence
Translation from 16 to 267
> BS27319.pep
MNFIQIAVLFVLVAVALARPQEDPANLPAPEAAAAPPAAAAAPPAAAAAP
PAPPAPPAAAPQAAPAGGSGRKKNVNHNVITIG*
BS27319.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
msopa-PB | 83 | CG14560-PB | 1..83 | 1..83 | 419 | 100 | Plus |
msopa-PA | 83 | CG14560-PA | 1..83 | 1..83 | 419 | 100 | Plus |