Clone BS27321 Report

Search the DGRC for BS27321

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:273
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptSP-RA
Protein status:BS27321.pep: gold
Sequenced Size:200

Clone Sequence Records

BS27321.complete Sequence

200 bp assembled on 2011-09-07

GenBank Submission: KX804729

> BS27321.complete
GAAGTTATCAGTCGACATGAAAACTCTAGCTCTATTCTTGGTTCTCGTTT
GCGTACTCGGCTTGGTCCAGGCCTGGGAATGGCCGTGGAATAGGAAGCCT
ACAAAGTTTCCAATTCCAAGCCCCAATCCTCGTGATAAGTGGTGCCGTCT
TAATTTGGGGCCCGCCTGGGGTGGAAGATGTTAAAAGCTTTCTAGACCAT

BS27321.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
SP-RA 168 CG17673-PA 1..168 17..184 840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
SP-RA 223 CG17673-RA 4..171 17..184 840 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13301638..13301754 17..133 585 100 Plus
3L 28110227 3L 13301818..13301870 132..184 265 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:51:36 has no hits.

BS27321.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:27 Download gff for BS27321.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 4..169 17..182 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:36 Download gff for BS27321.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 4..169 17..182 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:33:09 Download gff for BS27321.complete
Subject Subject Range Query Range Percent Splice Strand
SP-RA 4..169 17..182 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:33:09 Download gff for BS27321.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13301818..13301868 132..182 100   Plus
3L 13301638..13301752 17..131 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:36 Download gff for BS27321.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13294738..13294852 17..131 100 -> Plus
arm_3L 13294918..13294968 132..182 100   Plus

BS27321.pep Sequence

Translation from 16 to 183

> BS27321.pep
MKTLALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPA
WGGRC*

BS27321.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
SP-PA 55 CG17673-PA 1..55 1..55 324 100 Plus