BS27321.complete Sequence
200 bp assembled on 2011-09-07
GenBank Submission: KX804729
> BS27321.complete
GAAGTTATCAGTCGACATGAAAACTCTAGCTCTATTCTTGGTTCTCGTTT
GCGTACTCGGCTTGGTCCAGGCCTGGGAATGGCCGTGGAATAGGAAGCCT
ACAAAGTTTCCAATTCCAAGCCCCAATCCTCGTGATAAGTGGTGCCGTCT
TAATTTGGGGCCCGCCTGGGGTGGAAGATGTTAAAAGCTTTCTAGACCAT
BS27321.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:51:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SP-RA | 168 | CG17673-PA | 1..168 | 17..184 | 840 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:51:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SP-RA | 223 | CG17673-RA | 4..171 | 17..184 | 840 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:51:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13301638..13301754 | 17..133 | 585 | 100 | Plus |
3L | 28110227 | 3L | 13301818..13301870 | 132..184 | 265 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:51:36 has no hits.
BS27321.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:27 Download gff for
BS27321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 4..169 | 17..182 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:36 Download gff for
BS27321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 4..169 | 17..182 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:33:09 Download gff for
BS27321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
SP-RA | 4..169 | 17..182 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:33:09 Download gff for
BS27321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13301818..13301868 | 132..182 | 100 | | Plus |
3L | 13301638..13301752 | 17..131 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:36 Download gff for
BS27321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13294738..13294852 | 17..131 | 100 | -> | Plus |
arm_3L | 13294918..13294968 | 132..182 | 100 | | Plus |
BS27321.pep Sequence
Translation from 16 to 183
> BS27321.pep
MKTLALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPA
WGGRC*
BS27321.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SP-PA | 55 | CG17673-PA | 1..55 | 1..55 | 324 | 100 | Plus |