Clone BS27329 Report

Search the DGRC for BS27329

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:273
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptCG31922-RA
Protein status:BS27329.pep: gold
Sequenced Size:452

Clone Sequence Records

BS27329.complete Sequence

452 bp assembled on 2011-09-07

GenBank Submission: KX805202

> BS27329.complete
GAAGTTATCAGTCGACATGGGTGGCAAAAGTTATTATTGCGACTACTGCT
GTTGCTTTCTGAAAAACGATCTGAATGTGAGGAAATTGCACAATGGTGGT
ATTGCACACGCAATTGCAAAGAGCAACTATTTGAAGCGTTACGAGGATCC
CAAAAAGATTTTGACTGAAGAGCGGCAGAAAACTCCTTGCAAGCGATACT
TTGGCAGTTACTGCAAGTTTGAAACATATTGCAAGTTTACCCACTATAGT
GGCGATAATCTACGGGAACTGGAGAAGTTGGTTCTCGCTAGAAAGAAGAG
AAAATCCCGAAAGAAAACCAACAAATGCAAGAGATGGCCCTGGAAAACTC
ATCTGCGAAAGGGATTACCCCCTTCCTTGCAACCCATTAACCCGGAAAAA
CTCAAGCAAACCGACTTTGAACTCAGTTGGGGCTAAAAGCTTTCTAGACC
AT

BS27329.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG31922-RA 420 CG31922-PA 1..420 17..436 2100 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG31922-RA 497 CG31922-RA 54..474 17..437 2105 100 Plus
Plap-RC 2746 CG5105-RC 3..132 146..17 650 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1170610..1170766 281..437 785 100 Plus
2L 23513712 2L 1170418..1170553 146..281 680 100 Plus
2L 23513712 2L 1170234..1170363 17..146 650 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:52:55 has no hits.

BS27329.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:29 Download gff for BS27329.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 54..471 17..434 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:05 Download gff for BS27329.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 54..471 17..434 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:33:35 Download gff for BS27329.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 54..471 17..434 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:33:35 Download gff for BS27329.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1170234..1170363 17..146 100 -> Plus
2L 1170419..1170553 147..281 100 -> Plus
2L 1170611..1170763 282..434 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:05 Download gff for BS27329.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1170234..1170363 17..146 100 -> Plus
arm_2L 1170419..1170553 147..281 100 -> Plus
arm_2L 1170611..1170763 282..434 100   Plus

BS27329.pep Sequence

Translation from 16 to 435

> BS27329.pep
MGGKSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILT
EERQKTPCKRYFGSYCKFETYCKFTHYSGDNLRELEKLVLARKKRKSRKK
TNKCKRWPWKTHLRKGLPPSLQPINPEKLKQTDFELSWG*

BS27329.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31922-PA 139 CG31922-PA 1..139 1..139 783 100 Plus