Clone BS27332 Report

Search the DGRC for BS27332

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:273
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG14903-RA
Protein status:BS27332.pep: gold
Sequenced Size:392

Clone Sequence Records

BS27332.complete Sequence

392 bp assembled on 2011-09-07

GenBank Submission: KX802195

> BS27332.complete
GAAGTTATCAGTCGACATGAGTAATATTGTACAGTATATTGTAGTTCGCA
GCGACTTGCGTTCCGCCCTTAGTTGGCCCTTGGGGGCGGTGATCGCTCAG
AGTTGCCATGCCACAGCCGCCGTCATTCACTTGAATTCCGAGGACGCCGA
CACTGTGGCCTACTTGAACGATCTGGATAATATGCACAAAGTGGTGCTGG
AGGCCAAAGATGAGAGTGCTCTGGTCAAGCTCAGTGAAAAGTTAAAGGAG
AACGAGATTAAACACAAGTTGTGGATCGAACAGCCCGAAAATATCCCAAC
CTGCATCGCCTTGAAACCTTATGTTAAGGACACGGTTCATAAATATGTCA
AGCACCTTAAGCTTTTAAAAGAGTAAAAGCTTTCTAGACCAT

BS27332.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG14903-RA 360 CG14903-PA 1..360 17..376 1800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14903-RA 442 CG14903-RA 33..394 15..376 1810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16573532..16573720 203..15 945 100 Minus
3R 32079331 3R 16573227..16573402 376..201 880 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:53:06 has no hits.

BS27332.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:30 Download gff for BS27332.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 35..392 17..374 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:09 Download gff for BS27332.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 35..392 17..374 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:33:38 Download gff for BS27332.complete
Subject Subject Range Query Range Percent Splice Strand
CG14903-RA 35..392 17..374 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:33:38 Download gff for BS27332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16573229..16573400 203..374 100 <- Minus
3R 16573533..16573718 17..202 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:09 Download gff for BS27332.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12398951..12399122 203..374 100 <- Minus
arm_3R 12399255..12399440 17..202 100   Minus

BS27332.pep Sequence

Translation from 16 to 375

> BS27332.pep
MSNIVQYIVVRSDLRSALSWPLGAVIAQSCHATAAVIHLNSEDADTVAYL
NDLDNMHKVVLEAKDESALVKLSEKLKENEIKHKLWIEQPENIPTCIALK
PYVKDTVHKYVKHLKLLKE*

BS27332.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14903-PA 119 CG14903-PA 1..119 1..119 609 100 Plus