Clone BS27364 Report

Search the DGRC for BS27364

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:273
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptBG642167-RA
Protein status:BS27364.pep: gold
Sequenced Size:353

Clone Sequence Records

BS27364.complete Sequence

353 bp assembled on 2011-09-16

GenBank Submission: KX803853

> BS27364.complete
GAAGTTATCAGTCGACATGTCGTTAGCTGTATTGACTTTTCTAGTACTCT
GTGGATTTTCCTTTCAGCATCAGGCAGTTGCTGACTGCGGCGCAGAAACA
TCCGATCTCTGGAAGGATGATACGGATTCGGACGAAGGAACTTGCACTCA
AGCCTCGATAAATAATGATAGGAAGGAAGATCCATTTGAAAATGATCCAA
TTATAAGGCAATCGAAAAAGAAAGTGGAAAACAATGACAGCATGAATTCA
GAAGTTCAGTTGCCACTATTTCAGAATATAATAAAGATATTCAAGTTTAT
ATGGCTGGTGCTGAGTGTTTGGATGAATTGGAAGTAAAAGCTTTCTAGAC
CAT

BS27364.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-RA 321 CG34103-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-RA 384 CG34103-RA 22..343 16..337 1610 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25806663..25806920 80..337 1290 100 Plus
3R 32079331 3R 25806466..25806530 16..80 325 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:32:08 has no hits.

BS27364.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-16 10:15:53 Download gff for BS27364.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 1..319 17..335 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:47 Download gff for BS27364.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 1..319 17..335 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:00:18 Download gff for BS27364.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 23..341 17..335 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:00:18 Download gff for BS27364.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25806664..25806918 81..335 100   Plus
3R 25806467..25806530 17..80 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:47 Download gff for BS27364.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21632386..21632640 81..335 100   Plus
arm_3R 21632189..21632252 17..80 100 -> Plus

BS27364.pep Sequence

Translation from 16 to 336

> BS27364.pep
MSLAVLTFLVLCGFSFQHQAVADCGAETSDLWKDDTDSDEGTCTQASINN
DRKEDPFENDPIIRQSKKKVENNDSMNSEVQLPLFQNIIKIFKFIWLVLS
VWMNWK*

BS27364.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-PA 106 CG34103-PA 1..106 1..106 566 100 Plus