Clone BS27365 Report

Search the DGRC for BS27365

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:273
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG42500-RA
Protein status:BS27365.pep: gold
Sequenced Size:263

Clone Sequence Records

BS27365.complete Sequence

263 bp assembled on 2011-09-16

GenBank Submission: KX804735

> BS27365.complete
GAAGTTATCAGTCGACATGAAGTTCTTTGCTCTGTGTGCCTTCCTCCTCA
TTGCCCTGGCTACCGTCCAGGCAACTCCCGGTGATCTGCGCCATGTTCCT
GTAGGACACGGAGGACACCCAGTCAATGCTGGCCACGGACCTGTGGGACA
CGCTGGTCCTGTTGGACACGGTCCAGTTGTAGGCCATGGTCCAGTTGTAG
GCCATGGTCCAGTTGTGGGACATGGTGTTCATGGTCATTCTGGCTGAAAG
CTTTCTAGACCAT

BS27365.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42500-RB 231 CG42500-PB 1..231 17..247 1155 100 Plus
CG42500-RA 231 CG42500-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42500-RB 440 CG42500-RB 99..335 17..253 1170 99.6 Plus
CG42500-RA 344 CG42500-RA 3..239 17..253 1170 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14152316..14152552 253..17 1170 99.6 Minus
Blast to na_te.dros performed on 2014-11-27 07:40:14 has no hits.

BS27365.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-16 11:13:31 Download gff for BS27365.complete
Subject Subject Range Query Range Percent Splice Strand
CG42500-RA 3..232 17..246 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:15 Download gff for BS27365.complete
Subject Subject Range Query Range Percent Splice Strand
CG42500-RA 3..232 17..246 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:02:34 Download gff for BS27365.complete
Subject Subject Range Query Range Percent Splice Strand
CG42500-RA 3..232 17..246 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:02:34 Download gff for BS27365.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14152323..14152552 17..246 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:15 Download gff for BS27365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9978045..9978274 17..246 100   Minus

BS27365.pep Sequence

Translation from 16 to 246

> BS27365.pep
MKFFALCAFLLIALATVQATPGDLRHVPVGHGGHPVNAGHGPVGHAGPVG
HGPVVGHGPVVGHGPVVGHGVHGHSG*

BS27365.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42500-PB 76 CG42500-PB 1..76 1..76 429 100 Plus
CG42500-PA 76 CG42500-PA 1..76 1..76 429 100 Plus
CG17105-PB 103 CG17105-PB 1..75 1..76 130 44.2 Plus
CG17105-PA 103 CG17105-PA 1..75 1..76 130 44.2 Plus