BS27396.complete Sequence
308 bp assembled on 2011-09-16
GenBank Submission: KX805771
> BS27396.complete
GAAGTTATCAGTCGACATGCTGTTCAAAATATCGTGTCTCCTCATTCTTT
TGGTCTTCTGTCTGCAGCAGAGTTATTCGATCAAACGCAGATGCCTTCAG
CCACTGGATGTGGGCAAAGGCAAGGCCTATCTGCGCAATTGGTTCTACAA
CTCCACATCGCAGAGGTGCCAAAGGTTCATCTTCTATGGAGGCGCGAGCA
ATGGCAACAACTTCAATACCCAAGCTCGATGTCACAAAATTTGCCTAGCC
CAAGTCTCTTTGCCAATTAATTTCAACTCCACTGCCGCTTAAAAGCTTTC
TAGACCAT
BS27396.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:33:37
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34276-RB | 276 | CG34276-PB | 1..276 | 17..292 | 1380 | 100 | Plus |
| CG34276-RA | 276 | CG34276-PA | 1..276 | 17..292 | 1380 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:33:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34276-RB | 1819 | CG34276-RB | 550..828 | 16..294 | 1395 | 100 | Plus |
| CG34276-RA | 442 | CG34276-RA | 22..300 | 16..294 | 1395 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:33:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 15926373..15926586 | 81..294 | 1070 | 100 | Plus |
| 3R | 32079331 | 3R | 15926238..15926302 | 16..80 | 325 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 07:33:36 has no hits.
BS27396.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-16 10:15:55 Download gff for
BS27396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34276-RA | 135..408 | 17..290 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:14 Download gff for
BS27396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34276-RA | 160..433 | 17..290 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:00:43 Download gff for
BS27396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34276-RA | 23..296 | 17..290 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:00:43 Download gff for
BS27396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 15926239..15926302 | 17..80 | 100 | -> | Plus |
| 3R | 15926373..15926582 | 81..290 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:14 Download gff for
BS27396.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 11751961..11752024 | 17..80 | 100 | -> | Plus |
| arm_3R | 11752095..11752304 | 81..290 | 100 | | Plus |
BS27396.pep Sequence
Translation from 16 to 291
> BS27396.pep
MLFKISCLLILLVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQR
CQRFIFYGGASNGNNFNTQARCHKICLAQVSLPINFNSTAA*
BS27396.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:21:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34276-PB | 91 | CG34276-PB | 1..91 | 1..91 | 487 | 100 | Plus |
| CG34276-PA | 91 | CG34276-PA | 1..91 | 1..91 | 487 | 100 | Plus |
