Clone BS27422 Report

Search the DGRC for BS27422

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:274
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptDiedel3-RA
Protein status:BS27422.pep: gold
Sequenced Size:398

Clone Sequence Records

BS27422.complete Sequence

398 bp assembled on 2011-09-07

GenBank Submission: KX802678

> BS27422.complete
GAAGTTATCAGTCGACATGCGAGCGGTTTCGGTGTCAGTGCTACTCATCC
TTGTTGTCTGGGTGTCCTGTTTCGGCGAATCAGGCGCAGATTGCTGCTGG
ACAAAGGCCAAGCTGCTCTTCACGATGGGCACAGGATCGTGCGGAATGGT
CAATGCCAAGACCACCAAATACGGATGCGAGGCCACAGTTTGCGCGGATG
GAAGAGTGCTCAAGGGCACATATTGTGGCGTGGGTTCGTGCAATATCATT
GGATGCTTTTGTCGCGGCGGCTGTCTCACTGGAAACTATGGCGAGTCATT
TGTGGAAATAAATAATAGGTATCAGATCAACTTGATAAGCACCCAAATGA
GGCTTGCCAATTTAACAGATACCGAGGCCTAAAAGCTTTCTAGACCAT

BS27422.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel3-RB 366 CG34329-PB 1..366 17..382 1830 100 Plus
Diedel3-RA 366 CG34329-PA 1..366 17..382 1830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel3-RB 2719 CG34329-RB 32..397 17..382 1830 100 Plus
Diedel3-RA 534 CG34329-RA 32..397 17..382 1830 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19050473..19050838 17..382 1830 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:47:06 has no hits.

BS27422.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:14 Download gff for BS27422.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 1..364 17..380 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:54 Download gff for BS27422.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 1..364 17..380 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:31:44 Download gff for BS27422.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 32..395 17..380 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:31:44 Download gff for BS27422.complete
Subject Subject Range Query Range Percent Splice Strand
X 19050473..19050836 17..380 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:54 Download gff for BS27422.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18944506..18944869 17..380 100   Plus

BS27422.pep Sequence

Translation from 16 to 381

> BS27422.pep
MRAVSVSVLLILVVWVSCFGESGADCCWTKAKLLFTMGTGSCGMVNAKTT
KYGCEATVCADGRVLKGTYCGVGSCNIIGCFCRGGCLTGNYGESFVEINN
RYQINLISTQMRLANLTDTEA*

BS27422.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel3-PB 121 CG34329-PB 1..121 1..121 655 100 Plus
Diedel3-PA 121 CG34329-PA 1..121 1..121 655 100 Plus
Diedel2-PA 125 CG43228-PA 4..105 9..110 226 37.3 Plus
Diedel-PA 115 CG11501-PA 1..108 1..107 225 40.7 Plus