Clone BS27430 Report

Search the DGRC for BS27430

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:274
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG32551-RB
Protein status:BS27430.pep: gold
Sequenced Size:347

Clone Sequence Records

BS27430.complete Sequence

347 bp assembled on 2011-09-07

GenBank Submission: KX804485

> BS27430.complete
GAAGTTATCAGTCGACATGATTTCCGGACCCAGATTCTCTGCCCTACTAA
TCGTGGCCCTGACCCTCGCTCTGGTGGCCCAAACTTGGGCCGACGAGTTC
GATCTGGACTACTCCAACGAGTACGACGATGTGCGACCGCATTTGGTCTA
TCCCGACGATCCAAGGCTGGACAAGCGGATCGGCGATGCGGCGCGGGAGT
TTGGACAAAATATAACCCAAGCCTGGAACGCGATGGTGGACTCGTTTAAG
AACTACTTTGAGGAACTCAAGAACCTTTTCTCCGACACCACGGATCTCGA
TTCACCCAATGAAGTATTTTCTAACCGCTGAAAGCTTTCTAGACCAT

BS27430.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32551-RB 315 CG32551-PB 1..315 17..331 1575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG32551-RB 393 CG32551-RB 29..345 17..333 1585 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18438896..18439212 17..333 1585 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:45:04 has no hits.

BS27430.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-07 10:56:11 Download gff for BS27430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 29..342 17..330 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:01 Download gff for BS27430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 29..342 17..330 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:31:09 Download gff for BS27430.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 29..342 17..330 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:31:09 Download gff for BS27430.complete
Subject Subject Range Query Range Percent Splice Strand
X 18438896..18439209 17..330 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:01 Download gff for BS27430.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18332929..18333242 17..330 100   Plus

BS27430.pep Sequence

Translation from 16 to 330

> BS27430.pep
MISGPRFSALLIVALTLALVAQTWADEFDLDYSNEYDDVRPHLVYPDDPR
LDKRIGDAAREFGQNITQAWNAMVDSFKNYFEELKNLFSDTTDLDSPNEV
FSNR*

BS27430.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG32551-PB 104 CG32551-PB 1..104 1..104 546 100 Plus