Clone BS27595 Report

Search the DGRC for BS27595

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:275
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG32643-RA
Protein status:BS27595.pep: gold
Sequenced Size:338

Clone Sequence Records

BS27595.complete Sequence

338 bp assembled on 2011-09-12

GenBank Submission: KX801034

> BS27595.complete
GAAGTTATCAGTCGACATGTCCAGCCAGCAAAAACCCATCAATGTTTACG
TGCCGCCGATCAGCAGTTTTCCCGAAGCCAGTTTCCTGGGTGGCTATGGA
CTGCAGGATCGCATTGAGGTGCCCAAGAGCGCGGAAGTCCTTGAGGATGT
CATCGATGAGCGGGACGCGCACTTCCTCTACGTAGTCGATAGCCAGGGAC
GCCTGTTGGAGCACATACGTTACTACGGGGACGATTACCGGATGGCTTTG
CGTGAGGCCTTCACCACGAAAGTCCTTGACCAACAGAATACTGGCGCAGA
TCTCCCATTGAATCGGGAATAGAAGCTTTCTAGACCAT

BS27595.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-RA 306 CG32643-PA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-RA 548 CG32643-RA 87..393 16..322 1535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12984610..12984916 16..322 1535 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:07:29 has no hits.

BS27595.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 13:26:09 Download gff for BS27595.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 55..360 17..322 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:59 Download gff for BS27595.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 88..393 17..322 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:34 Download gff for BS27595.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 88..393 17..322 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:34 Download gff for BS27595.complete
Subject Subject Range Query Range Percent Splice Strand
X 12984611..12984916 17..322 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:59 Download gff for BS27595.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12878644..12878949 17..322 100   Plus

BS27595.pep Sequence

Translation from 16 to 321

> BS27595.pep
MSSQQKPINVYVPPISSFPEASFLGGYGLQDRIEVPKSAEVLEDVIDERD
AHFLYVVDSQGRLLEHIRYYGDDYRMALREAFTTKVLDQQNTGADLPLNR
E*

BS27595.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-PA 101 CG32643-PA 1..101 1..101 521 100 Plus