BS27596.complete Sequence
326 bp assembled on 2011-09-12
GenBank Submission: KX803998
> BS27596.complete
GAAGTTATCAGTCGACATGGCCGCCCCAGCACCAGCACTCAAGGATCTGC
CCAAGGTGGCCGAGAACCTGAAAAGCCAGTTGGAGGGATTCAACCAGGAC
AAACTGAAGAACGCTAGCACCCAGGAGAAGATCATTCTTCCCACCGCCGA
AGATGTGGCTGCCGAGAAGACCCAACAGTCGATCTTCGAGGGCATCACCG
CTTTCAATCAGAACAACTTGAAGCACACGGAGACCAACGAGAAGAACCCG
TTGCCCGATAAGGAAGGAGAAGGAGAAGAATCAGTTCATCGCCGGCATCG
AGAACTTTGAAAGCTTTCTAGACCAT
BS27596.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:59:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| cib-RC | 294 | CG4944-PC | 1..294 | 17..310 | 1470 | 100 | Plus |
| cib-RE | 390 | CG4944-PE | 1..305 | 17..310 | 1325 | 96.4 | Plus |
| cib-RD | 390 | CG4944-PD | 1..305 | 17..310 | 1325 | 96.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:59:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| cib-RC | 885 | CG4944-RC | 162..455 | 17..310 | 1470 | 100 | Plus |
| cib-RE | 911 | CG4944-RE | 177..481 | 17..310 | 1325 | 96.4 | Plus |
| cib-RD | 1502 | CG4944-RD | 423..727 | 17..310 | 1325 | 96.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:59:37
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 4109689..4109824 | 17..152 | 680 | 100 | Plus |
| X | 23542271 | X | 4109895..4110011 | 151..267 | 585 | 100 | Plus |
| X | 23542271 | X | 4110161..4110206 | 265..310 | 230 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 06:59:38 has no hits.
BS27596.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:53:26 Download gff for
BS27596.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| cib-RC | 160..452 | 17..309 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:45 Download gff for
BS27596.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| cib-RC | 162..454 | 17..309 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:00:11 Download gff for
BS27596.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| cib-RC | 162..454 | 17..309 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:00:11 Download gff for
BS27596.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 4109689..4109824 | 17..152 | 100 | -> | Plus |
| X | 4109897..4110010 | 153..266 | 100 | -> | Plus |
| X | 4110163..4110205 | 267..309 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:45 Download gff for
BS27596.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 4003722..4003857 | 17..152 | 100 | -> | Plus |
| arm_X | 4003930..4004043 | 153..266 | 100 | -> | Plus |
| arm_X | 4004196..4004238 | 267..309 | 100 | | Plus |
BS27596.pep Sequence
Translation from 16 to 309
> BS27596.pep
MAAPAPALKDLPKVAENLKSQLEGFNQDKLKNASTQEKIILPTAEDVAAE
KTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEGEGEESVHRRHREL*
BS27596.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:12:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| cib-PC | 97 | CG4944-PC | 1..97 | 1..97 | 495 | 100 | Plus |
| cib-PE | 129 | CG4944-PE | 1..88 | 1..88 | 422 | 95.5 | Plus |
| cib-PD | 129 | CG4944-PD | 1..88 | 1..88 | 422 | 95.5 | Plus |
| cib-PB | 129 | CG4944-PB | 1..88 | 1..88 | 422 | 95.5 | Plus |
| cib-PA | 129 | CG4944-PA | 1..88 | 1..88 | 422 | 95.5 | Plus |
