Clone BS27712 Report

Search the DGRC for BS27712

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:277
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG42758-RA
Protein status:BS27712.pep: full length peptide match
Sequenced Size:407

Clone Sequence Records

BS27712.complete Sequence

407 bp assembled on 2011-09-22

GenBank Submission: KX804528

> BS27712.complete
GAAGTTATCAGTCGACATGTGCATGCAAGTTCCACGGTTTGGATGTCGAG
TTCCAGTTTCCAGTTCCCGTTGTAAGACCGGTGCAACCAGATCTTGTCGA
AAGCCCGGATCTCGCTACAGAACCTTCTGCACTCCACCACCTCGCTGTAG
TCCCAGATCCTGCTGCACATCCGAATCCTGCTGCAAATCCGGGTCCTGCT
GCGGACCATGTGGGTCATGCTCGAATGGCTGTGCCGCCTGCTTATCCTCC
TGCTGTGGGATATTCCCCGAAACCTGCTGTGGTCCGTGGTGTGAGTCCTG
TCTGGATCCTTCCTGGTTCTCATGGCTGGCTCCCGATCTCGGGCGATCCT
GCTGTTGTGCTTGCATGACCTGTTGTCGATCCAAGTGCTGAAAGCTTTCT
AGACCAT

BS27712.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42758-RA 375 CG42758-PA 1..375 17..391 1875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42758-RA 631 CG42758-RA 180..555 16..391 1880 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14567682..14568057 16..391 1880 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:19:36 has no hits.

BS27712.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:40:56 Download gff for BS27712.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 181..554 17..390 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:29 Download gff for BS27712.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 181..554 17..390 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:15:55 Download gff for BS27712.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 181..554 17..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:15:55 Download gff for BS27712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14567683..14568056 17..390 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:29 Download gff for BS27712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14560783..14561156 17..390 100   Plus

BS27712.pep Sequence

Translation from 16 to 390

> BS27712.pep
MCMQVPRFGCRVPVSSSRCKTGATRSCRKPGSRYRTFCTPPPRCSPRSCC
TSESCCKSGSCCGPCGSCSNGCAACLSSCCGIFPETCCGPWCESCLDPSW
FSWLAPDLGRSCCCACMTCCRSKC*

BS27712.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42758-PA 124 CG42758-PA 1..124 1..124 764 100 Plus
Pif2-PA 118 CG31483-PA 2..69 44..124 160 42 Plus
Pif2-PA 118 CG31483-PA 18..117 38..124 137 35 Plus