Clone BS27728 Report

Search the DGRC for BS27728

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:277
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG15283-RB
Protein status:BS27728.pep: full length peptide match
Sequenced Size:413

Clone Sequence Records

BS27728.complete Sequence

413 bp assembled on 2011-09-22

GenBank Submission: KX805711

> BS27728.complete
GAAGTTATCAGTCGACATGATTAGATCCTGTCGAGCTCTGATCTCCCAGT
GCGGATTACACCTAAGACGATGTTCTCTTGCAAAGGCAGCAAGTAATTTG
AAAAAAGATGATGTCGAAGAAATGGAAACACCAGCGAATAGACAGAGGGT
TGAGCTGCCACCGAATCCCGAGGAAAAACTAAGTAAGCGCTATCTTGCGT
TCCGGGAAAAGCTGCGATCGGAGGCGCCGCTAGAACCACTGCCCGAGTGT
GCACCACATCCGGCCCACGAAAAGGAGCCACTTAAACCGTGGCCCAATAA
TACCAATCCGTATACCGGGGAAATCGGTGGACAAGCGGGACCAGAACCCA
CGCGCTATGGCGACTGGGAGCGCAAGGGACGAGTCACGGATTTCTGAAAG
CTTTCTAGACCAT

BS27728.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-RB 381 CG15283-PB 1..381 17..397 1905 100 Plus
Sirup-RC 357 CG7224-PC 216..355 256..395 340 82.9 Plus
Sirup-RA 357 CG7224-PA 216..355 256..395 340 82.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-RB 641 CG15283-RB 63..443 17..397 1905 100 Plus
Sirup-RC 727 CG7224-RC 460..599 256..395 340 82.9 Plus
Sirup-RA 650 CG7224-RA 383..522 256..395 340 82.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14450480..14450860 397..17 1905 100 Minus
2L 23513712 2L 7999409..7999548 256..395 340 82.9 Plus
Blast to na_te.dros performed on 2014-11-27 08:30:08 has no hits.

BS27728.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:41:05 Download gff for BS27728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 63..442 17..396 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:32 Download gff for BS27728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 63..442 17..396 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:20:25 Download gff for BS27728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 63..442 17..396 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:20:25 Download gff for BS27728.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14450481..14450860 17..396 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:32 Download gff for BS27728.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14450481..14450860 17..396 100   Minus

BS27728.pep Sequence

Translation from 16 to 396

> BS27728.pep
MIRSCRALISQCGLHLRRCSLAKAASNLKKDDVEEMETPANRQRVELPPN
PEEKLSKRYLAFREKLRSEAPLEPLPECAPHPAHEKEPLKPWPNNTNPYT
GEIGGQAGPEPTRYGDWERKGRVTDF*

BS27728.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-PB 126 CG15283-PB 1..126 1..126 688 100 Plus
Sirup-PC 118 CG7224-PC 48..118 56..126 289 70.4 Plus
Sirup-PA 118 CG7224-PA 48..118 56..126 289 70.4 Plus