Clone BS27738 Report

Search the DGRC for BS27738

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:277
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCp7Fb-RB
Protein status:BS27738.pep: full length peptide match
Sequenced Size:452

Clone Sequence Records

BS27738.complete Sequence

452 bp assembled on 2011-09-22

GenBank Submission: KX801196

> BS27738.complete
GAAGTTATCAGTCGACATGCGATACTCCATGGCAATGATCCCGATTCTGG
GCCTGCTGCTCGTAGCACTGATCCACGCCGCTCCCGTTGAGGTCGTCTAC
ACGGGCGAAAGTTGCGCCTGTCCCACCCAACTGGGTTACCAGCTAAATGT
GCCCAATACCCCAAAGCCAAAGAAGTATGTCGGTGGCGAGTACGGCTATC
GGGTGGAGAAGCCCGTCCAGACGAAAGCCAAGATTACCTACAGCTTTGAC
TTCACTGTGGAGCAGCCGAGGACACCGGCGCCGCCCAAGAACAATCCCGC
CAAGCTGTATGCCAAGGTGGACCGGATCACAGTCAACAAAGCGGATTGCC
AGGCCAAGAACAAGTCAACATGCGGCTGCTCGAGTTGCTCCGGCCAAAAA
CCCAGCTACGGCGAAGACGCGGGCTACGGCTACTGAAAGCTTTCTAGACC
AT

BS27738.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fb-RB 420 CG15350-PB 1..420 17..436 2100 100 Plus
Cp7Fb-RA 1503 CG15350-PA 1..394 17..410 1955 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fb-RB 775 CG15350-RB 34..458 13..437 2110 99.8 Plus
Cp7Fb-RA 2093 CG15350-RA 34..431 13..410 1960 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8473870..8474201 13..344 1645 99.7 Plus
X 23542271 X 8474343..8474409 344..410 320 98.5 Plus
Blast to na_te.dros performed on 2014-11-27 08:34:15 has no hits.

BS27738.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:41:08 Download gff for BS27738.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fb-RB 670..1088 17..435 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:00:23 Download gff for BS27738.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fb-RB 38..456 17..435 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:22:14 Download gff for BS27738.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fb-RB 38..456 17..435 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:22:14 Download gff for BS27738.complete
Subject Subject Range Query Range Percent Splice Strand
X 8475723..8475752 406..435 100   Plus
X 8473874..8474201 17..344 100 -> Plus
X 8474344..8474404 345..405 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:00:23 Download gff for BS27738.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8367907..8368234 17..344 100 -> Plus
arm_X 8368377..8368437 345..405 100 -> Plus
arm_X 8369756..8369785 406..435 100   Plus

BS27738.pep Sequence

Translation from 16 to 435

> BS27738.pep
MRYSMAMIPILGLLLVALIHAAPVEVVYTGESCACPTQLGYQLNVPNTPK
PKKYVGGEYGYRVEKPVQTKAKITYSFDFTVEQPRTPAPPKNNPAKLYAK
VDRITVNKADCQAKNKSTCGCSSCSGQKPSYGEDAGYGY*

BS27738.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fb-PB 139 CG15350-PB 1..139 1..139 749 100 Plus
Cp7Fb-PA 500 CG15350-PA 1..131 1..131 697 99.2 Plus