Clone BS27765 Report

Search the DGRC for BS27765

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:277
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptArpc3A-RD
Protein status:BS27765.pep: wuzgold
Sequenced Size:515

Clone Sequence Records

BS27765.complete Sequence

515 bp assembled on 2011-09-22

GenBank Submission: KX806359

> BS27765.complete
GAAGTTATCAGTCGACATGGCCATCCTGCCGCTGAGGACGCAGGTGCGCG
GGCCAGCGCCCAGTGCGAATATTGAGAGCGACATCATTGATGAGTCACTG
TACTACTTCAAAGCCAATGTCTTCTTTCGCACGTACGAAATCAAGTCCGA
CGTGGATCGCGTGCTCATCTATGTGACGCTCTACATAACAGAGTGCCTCA
AGAAGCTCAATCGCTCCACGAGCAAGGCCCAGGGACAGCAGGACATGTAC
AGCCTGGCCATCTCCAAGTTCGACATTCCCGGCGATGCTGGCTTCCCATT
GAACGCCGTCTATGCCAAGCCGCAAACGGCCCAGGATGCGGATCTGATGC
GCCAGTACCTGCTGCAGCTGCGCCACGAAACCGGCAACCGGGTACTGGAG
AAGGTCTTCAACACCGAGGATGGCAAGCCCAATAAATGGTGGACCTGCTT
CGCGAAGAAAAAGTTCATGGAGAAGAGTCTGGCTGGACCTGGACAATAAA
AGCTTTCTAGACCAT

BS27765.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-RE 534 CG4560-PE 50..534 15..499 2425 100 Plus
Arpc3A-RC 534 CG4560-PC 50..534 15..499 2425 100 Plus
Arpc3B-RC 474 CG8936-PC 37..468 53..493 415 73.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-RE 1123 CG4560-RE 168..653 15..500 2430 100 Plus
Arpc3A-RC 814 CG4560-RC 168..653 15..500 2430 100 Plus
Arpc3B-RC 693 CG8936-RC 185..616 53..493 415 73.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15835195..15835551 144..500 1785 100 Plus
3R 32079331 3R 15834956..15835086 15..145 655 100 Plus
X 23542271 X 17104648..17104808 493..333 310 79.5 Minus
Blast to na_te.dros performed on 2014-11-27 08:45:08 has no hits.

BS27765.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:41:12 Download gff for BS27765.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RD 291..771 17..497 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:36 Download gff for BS27765.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 170..650 17..497 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:25:48 Download gff for BS27765.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 170..650 17..497 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:25:48 Download gff for BS27765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15834958..15835086 17..145 100 -> Plus
3R 15835197..15835548 146..497 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:36 Download gff for BS27765.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11660680..11660808 17..145 100 -> Plus
arm_3R 11660919..11661270 146..497 100   Plus

BS27765.pep Sequence

Translation from 16 to 498

> BS27765.pep
MAILPLRTQVRGPAPSANIESDIIDESLYYFKANVFFRTYEIKSDVDRVL
IYVTLYITECLKKLNRSTSKAQGQQDMYSLAISKFDIPGDAGFPLNAVYA
KPQTAQDADLMRQYLLQLRHETGNRVLEKVFNTEDGKPNKWWTCFAKKKF
MEKSLAGPGQ*

BS27765.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-PE 177 CG4560-PE 18..177 1..160 834 100 Plus
Arpc3A-PC 177 CG4560-PC 18..177 1..160 834 100 Plus
Arpc3B-PC 157 CG8936-PC 1..156 1..159 666 76.1 Plus
Arpc3B-PB 157 CG8936-PB 1..156 1..159 666 76.1 Plus
Arpc3B-PA 174 CG8936-PA 18..173 1..159 666 76.1 Plus