Clone BS27784 Report

Search the DGRC for BS27784

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:277
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptCG34288-RB
Protein status:BS27784.pep: gold
Sequenced Size:212

Clone Sequence Records

BS27784.complete Sequence

212 bp assembled on 2011-09-22

GenBank Submission: KX801783

> BS27784.complete
GAAGTTATCAGTCCCCATGGGGTGTTGTTTTGGCAAAAGTAAATCAGTCG
ATTTGCCCGCGGTTCCGCCGGCTCCAGCCAAACAACGCTCCACTCTGCCA
GAATTCCCGATTTCTGGATCGGTGACTAGCACGGCTCCTGCAGGATCTGG
ATATGGATCTGGAGGAGCCACCAATGCGGCCCTCGAGGATGACTAGAAGC
TTTCTAGACCAT

BS27784.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-RB 180 CG34288-PB 1..180 17..196 885 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-RB 436 CG34288-RB 48..228 17..197 890 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22446971..22447136 197..32 830 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:16:57 has no hits.

BS27784.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:40:54 Download gff for BS27784.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 48..227 17..196 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:05 Download gff for BS27784.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 48..227 17..196 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:14:50 Download gff for BS27784.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 48..227 17..196 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:14:50 Download gff for BS27784.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22446972..22447141 25..196 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:05 Download gff for BS27784.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18272694..18272863 25..196 97   Minus

BS27784.pep Sequence

Translation from 16 to 195

> BS27784.pep
MGCCFGKSKSVDLPAVPPAPAKQRSTLPEFPISGSVTSTAPAGSGYGSGG
ATNAALEDD*

BS27784.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-PB 59 CG34288-PB 1..59 1..59 310 100 Plus