Clone BS27790 Report

Search the DGRC for BS27790

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:277
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG34300-RB
Protein status:BS27790.pep: full length peptide match
Sequenced Size:296

Clone Sequence Records

BS27790.complete Sequence

296 bp assembled on 2011-09-22

GenBank Submission: KX803818

> BS27790.complete
GAAGTTATCAGTCGACATGGTGCACTTTTTTGGATCGATTTTTCTGATGA
TGAGCAGTATCTTGATCGAATTTCTGGTGATCATCTATCTGGTAACAGAT
ATAATCCACCTGATCTTTTGTAGCCCCTTTATAATCAATTATGCGTTAAG
TTGTAGCTTCTGCACTCTAGAATCGATTCCTGTATTCTTCACCCTAGCTT
TTAGCCTTTATTTTTGGATAGTGGCATTTTTCTACTGGCGACGCCTTCTC
TGGGAACACAATCCCGAAAACGACGACTGAAAGCTTTCTAGACCAT

BS27790.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34300-RB 264 CG34300-PB 1..264 17..280 1320 100 Plus
CG34300-RA 423 CG34300-PA 157..423 17..280 1255 98.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG34300-RB 635 CG34300-RB 164..427 17..280 1320 100 Plus
CG34300-RA 631 CG34300-RA 157..423 17..280 1255 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30306159..30306292 197..64 670 100 Minus
3R 32079331 3R 30306016..30306100 280..196 425 100 Minus
3R 32079331 3R 30306348..30306395 64..17 240 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:10:04 has no hits.

BS27790.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:40:50 Download gff for BS27790.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RB 164..426 17..279 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:02 Download gff for BS27790.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RB 164..426 17..279 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:12:20 Download gff for BS27790.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RB 164..426 17..279 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:12:20 Download gff for BS27790.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30306017..30306098 198..279 100 <- Minus
3R 30306159..30306291 65..197 100 <- Minus
3R 30306348..30306395 17..64 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:02 Download gff for BS27790.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26131881..26132013 65..197 100 <- Minus
arm_3R 26132070..26132117 17..64 100   Minus
arm_3R 26131739..26131820 198..279 100 <- Minus

BS27790.pep Sequence

Translation from 16 to 279

> BS27790.pep
MVHFFGSIFLMMSSILIEFLVIIYLVTDIIHLIFCSPFIINYALSCSFCT
LESIPVFFTLAFSLYFWIVAFFYWRRLLWEHNPENDD*

BS27790.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34300-PB 87 CG34300-PB 1..87 1..87 469 100 Plus
CG34300-PA 140 CG34300-PA 53..140 1..87 457 98.9 Plus