BS27790.complete Sequence
296 bp assembled on 2011-09-22
GenBank Submission: KX803818
> BS27790.complete
GAAGTTATCAGTCGACATGGTGCACTTTTTTGGATCGATTTTTCTGATGA
TGAGCAGTATCTTGATCGAATTTCTGGTGATCATCTATCTGGTAACAGAT
ATAATCCACCTGATCTTTTGTAGCCCCTTTATAATCAATTATGCGTTAAG
TTGTAGCTTCTGCACTCTAGAATCGATTCCTGTATTCTTCACCCTAGCTT
TTAGCCTTTATTTTTGGATAGTGGCATTTTTCTACTGGCGACGCCTTCTC
TGGGAACACAATCCCGAAAACGACGACTGAAAGCTTTCTAGACCAT
BS27790.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:10:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34300-RB | 264 | CG34300-PB | 1..264 | 17..280 | 1320 | 100 | Plus |
CG34300-RA | 423 | CG34300-PA | 157..423 | 17..280 | 1255 | 98.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34300-RB | 635 | CG34300-RB | 164..427 | 17..280 | 1320 | 100 | Plus |
CG34300-RA | 631 | CG34300-RA | 157..423 | 17..280 | 1255 | 98.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 30306159..30306292 | 197..64 | 670 | 100 | Minus |
3R | 32079331 | 3R | 30306016..30306100 | 280..196 | 425 | 100 | Minus |
3R | 32079331 | 3R | 30306348..30306395 | 64..17 | 240 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 08:10:04 has no hits.
BS27790.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:40:50 Download gff for
BS27790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34300-RB | 164..426 | 17..279 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:02 Download gff for
BS27790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34300-RB | 164..426 | 17..279 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:12:20 Download gff for
BS27790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34300-RB | 164..426 | 17..279 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:12:20 Download gff for
BS27790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30306017..30306098 | 198..279 | 100 | <- | Minus |
3R | 30306159..30306291 | 65..197 | 100 | <- | Minus |
3R | 30306348..30306395 | 17..64 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:02 Download gff for
BS27790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 26131881..26132013 | 65..197 | 100 | <- | Minus |
arm_3R | 26132070..26132117 | 17..64 | 100 | | Minus |
arm_3R | 26131739..26131820 | 198..279 | 100 | <- | Minus |
BS27790.pep Sequence
Translation from 16 to 279
> BS27790.pep
MVHFFGSIFLMMSSILIEFLVIIYLVTDIIHLIFCSPFIINYALSCSFCT
LESIPVFFTLAFSLYFWIVAFFYWRRLLWEHNPENDD*
BS27790.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:16:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34300-PB | 87 | CG34300-PB | 1..87 | 1..87 | 469 | 100 | Plus |
CG34300-PA | 140 | CG34300-PA | 53..140 | 1..87 | 457 | 98.9 | Plus |