Clone BS27793 Report

Search the DGRC for BS27793

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:277
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptSIFa-RB
Protein status:BS27793.pep: full length peptide match
Sequenced Size:251

Clone Sequence Records

BS27793.complete Sequence

251 bp assembled on 2011-09-22

GenBank Submission: KX804796

> BS27793.complete
GAAGTTATCAGTCGACATGGCTCTTCGATTCACACTCACTCTGCTCCTGG
TCACGATCCTGGTCGCAGCCATACTTTTGGGCTCCAGTGAGGCAGCCTAC
AGGAAGCCTCCGTTCAACGGCAGCATCTTCGGCAAACGCAACAGCCTAGA
CTACGACAGCGCCAAAATGAGCGCCGTTTGCGAGGTGGCCATGGAGGCGT
GTCCCATGTGGTTTCCCCAGAACGACAGCAAATAGAAGCTTTCTAGACCA
T

BS27793.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
SIFa-RB 219 CG33527-PB 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
SIFa-RB 526 CG33527-RB 78..296 17..235 1095 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24577934..24578066 149..17 665 100 Minus
2R 25286936 2R 24577796..24577883 235..148 440 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:11:37 has no hits.

BS27793.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:40:51 Download gff for BS27793.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RB 69..281 17..229 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:11 Download gff for BS27793.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RB 78..290 17..229 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:12:53 Download gff for BS27793.complete
Subject Subject Range Query Range Percent Splice Strand
SIFa-RB 78..290 17..229 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:12:53 Download gff for BS27793.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24577802..24577881 150..229 100 <- Minus
2R 24577934..24578066 17..149 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:11 Download gff for BS27793.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20465325..20465404 150..229 100 <- Minus
arm_2R 20465457..20465589 17..149 100   Minus

BS27793.pep Sequence

Translation from 16 to 234

> BS27793.pep
MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAK
MSAVCEVAMEACPMWFPQNDSK*

BS27793.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
SIFa-PB 72 CG33527-PB 1..72 1..72 367 100 Plus