BS27793.complete Sequence
251 bp assembled on 2011-09-22
GenBank Submission: KX804796
> BS27793.complete
GAAGTTATCAGTCGACATGGCTCTTCGATTCACACTCACTCTGCTCCTGG
TCACGATCCTGGTCGCAGCCATACTTTTGGGCTCCAGTGAGGCAGCCTAC
AGGAAGCCTCCGTTCAACGGCAGCATCTTCGGCAAACGCAACAGCCTAGA
CTACGACAGCGCCAAAATGAGCGCCGTTTGCGAGGTGGCCATGGAGGCGT
GTCCCATGTGGTTTCCCCAGAACGACAGCAAATAGAAGCTTTCTAGACCA
T
BS27793.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:11:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SIFa-RB | 219 | CG33527-PB | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:11:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SIFa-RB | 526 | CG33527-RB | 78..296 | 17..235 | 1095 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:11:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24577934..24578066 | 149..17 | 665 | 100 | Minus |
2R | 25286936 | 2R | 24577796..24577883 | 235..148 | 440 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 08:11:37 has no hits.
BS27793.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:40:51 Download gff for
BS27793.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IFa-RB | 69..281 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:11 Download gff for
BS27793.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IFa-RB | 78..290 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:12:53 Download gff for
BS27793.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
SIFa-RB | 78..290 | 17..229 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:12:53 Download gff for
BS27793.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24577802..24577881 | 150..229 | 100 | <- | Minus |
2R | 24577934..24578066 | 17..149 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:11 Download gff for
BS27793.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 20465325..20465404 | 150..229 | 100 | <- | Minus |
arm_2R | 20465457..20465589 | 17..149 | 100 | | Minus |
BS27793.pep Sequence
Translation from 16 to 234
> BS27793.pep
MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAK
MSAVCEVAMEACPMWFPQNDSK*
BS27793.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:17:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SIFa-PB | 72 | CG33527-PB | 1..72 | 1..72 | 367 | 100 | Plus |