BS27973.complete Sequence
293 bp assembled on 2011-09-30
GenBank Submission: KX804577
> BS27973.complete
GAAGTTATCAGTCGACATGAGTAAATACGACTCAAAGTACCTCGAGGAGA
AGCTCAAACGGGAACTGCAGACGGAGTACGTGAGTGTTACGGACGAATCA
GACGGCTGTGGCGGCAAGTTCAGCGCCGTAATCGTATCGCCAGCCTTCAG
CGGCAAGACCCTTCTCCAGAAGCATAGATTAGTTAACTCAACGCTTGCCG
AAGAACTGAAAGAAATCCATGCATTCTCCCAGAAATCCTACACACCCGAA
GAGTGGGAGAAAGTGAAAGCCCAATAGAAGCTTTCTAGACCAT
BS27973.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:01:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33672-RA | 261 | CG33672-PA | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:01:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33672-RA | 1976 | CG33672-RA | 58..318 | 17..277 | 1305 | 100 | Plus |
CG33671-RA | 1976 | CG33671-RA | 58..318 | 17..277 | 1305 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:01:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12635824..12636084 | 277..17 | 1305 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 11:01:01 has no hits.
BS27973.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-30 10:50:06 Download gff for
BS27973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33672-RA | 78..338 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:00:54 Download gff for
BS27973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33672-RA | 58..318 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:36:43 Download gff for
BS27973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33671-RA | 58..318 | 17..277 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:36:43 Download gff for
BS27973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12635824..12636084 | 17..277 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:00:54 Download gff for
BS27973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8523329..8523589 | 17..277 | 100 | | Minus |
BS27973.pep Sequence
Translation from 16 to 276
> BS27973.pep
MSKYDSKYLEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLL
QKHRLVNSTLAEELKEIHAFSQKSYTPEEWEKVKAQ*
BS27973.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:24:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33672-PA | 86 | CG33672-PA | 1..86 | 1..86 | 438 | 100 | Plus |