Clone BS27973 Report

Search the DGRC for BS27973

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:279
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG33672-RA
Protein status:BS27973.pep: full length peptide match
Sequenced Size:293

Clone Sequence Records

BS27973.complete Sequence

293 bp assembled on 2011-09-30

GenBank Submission: KX804577

> BS27973.complete
GAAGTTATCAGTCGACATGAGTAAATACGACTCAAAGTACCTCGAGGAGA
AGCTCAAACGGGAACTGCAGACGGAGTACGTGAGTGTTACGGACGAATCA
GACGGCTGTGGCGGCAAGTTCAGCGCCGTAATCGTATCGCCAGCCTTCAG
CGGCAAGACCCTTCTCCAGAAGCATAGATTAGTTAACTCAACGCTTGCCG
AAGAACTGAAAGAAATCCATGCATTCTCCCAGAAATCCTACACACCCGAA
GAGTGGGAGAAAGTGAAAGCCCAATAGAAGCTTTCTAGACCAT

BS27973.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG33672-RA 261 CG33672-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG33672-RA 1976 CG33672-RA 58..318 17..277 1305 100 Plus
CG33671-RA 1976 CG33671-RA 58..318 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:01:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12635824..12636084 277..17 1305 100 Minus
Blast to na_te.dros performed on 2014-11-27 11:01:01 has no hits.

BS27973.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-30 10:50:06 Download gff for BS27973.complete
Subject Subject Range Query Range Percent Splice Strand
CG33672-RA 78..338 17..277 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:00:54 Download gff for BS27973.complete
Subject Subject Range Query Range Percent Splice Strand
CG33672-RA 58..318 17..277 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:36:43 Download gff for BS27973.complete
Subject Subject Range Query Range Percent Splice Strand
CG33671-RA 58..318 17..277 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:36:43 Download gff for BS27973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12635824..12636084 17..277 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:00:54 Download gff for BS27973.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8523329..8523589 17..277 100   Minus

BS27973.pep Sequence

Translation from 16 to 276

> BS27973.pep
MSKYDSKYLEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLL
QKHRLVNSTLAEELKEIHAFSQKSYTPEEWEKVKAQ*

BS27973.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG33672-PA 86 CG33672-PA 1..86 1..86 438 100 Plus