Clone BS27994 Report

Search the DGRC for BS27994

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:279
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG42792-RA
Protein status:BS27994.pep: gold
Sequenced Size:299

Clone Sequence Records

BS27994.complete Sequence

299 bp assembled on 2011-10-04

GenBank Submission: KX805985

> BS27994.complete
GAAGTTATCAGTCGACATGTCTCCTAAGTTCGCACTTGCAGTTCTGCTCC
TCAGCTGCGTTCTCCTAGGACTGGCCAATGCCCAGTATAACAGGCGCTAT
CAGACTGGGCCTAACCGACAAAAAATTGGGACTCGAATGAATGCGGACGG
CCCTTTGCCGCCAAATTTCCCCCCTCCGGCTGATAATGCTGGTGGCAGTG
ATGTCCCGGCCAACGTGGATTGCATGCCCAATCTATTGGCTAGTAACACC
CTTGATACCAGGAAACCTAGGCCCAAGCATTAAAAGCTTTCTAGACCAT

BS27994.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42792-RA 267 CG42792-PA 1..267 17..283 1335 100 Plus
CG42792-RB 267 CG42792-PB 1..267 17..283 1335 100 Plus
CG44475-RA 246 CG44475-PA 1..246 17..283 775 86.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG42792-RA 397 CG42792-RA 7..275 17..285 1345 100 Plus
CG42792-RB 468 CG42792-RB 39..307 17..285 1345 100 Plus
CG44475-RA 343 CG44475-RA 18..263 17..283 775 86.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15865090..15865250 285..125 805 100 Minus
2L 23513712 2L 15865316..15865423 124..17 540 100 Minus
2L 23513712 2L 15882863..15882974 283..172 455 93.8 Minus
2L 23513712 2L 15883066..15883173 124..17 435 93.5 Minus
Blast to na_te.dros performed on 2014-11-27 13:27:25 has no hits.

BS27994.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-10-04 15:39:38 Download gff for BS27994.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RA 1..265 17..281 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:44:59 Download gff for BS27994.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RA 7..271 17..281 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:18:46 Download gff for BS27994.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RB 39..303 17..281 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:18:46 Download gff for BS27994.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15865094..15865250 125..281 100 <- Minus
2L 15865316..15865423 17..124 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:44:59 Download gff for BS27994.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15865094..15865250 125..281 100 <- Minus
arm_2L 15865316..15865423 17..124 100   Minus

BS27994.pep Sequence

Translation from 16 to 282

> BS27994.pep
MSPKFALAVLLLSCVLLGLANAQYNRRYQTGPNRQKIGTRMNADGPLPPN
FPPPADNAGGSDVPANVDCMPNLLASNTLDTRKPRPKH*

BS27994.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42792-PA 88 CG42792-PA 1..88 1..88 472 100 Plus
CG42792-PB 88 CG42792-PB 1..88 1..88 472 100 Plus
CG44475-PA 81 CG44475-PA 1..81 1..88 382 85.2 Plus