BS28090.complete Sequence
233 bp assembled on 2011-09-30
GenBank Submission: KX802702
> BS28090.complete
GAAGTTATCAGTCGACATGTTCAATATAAAGTTAATCATCCTGGTTGCCC
TGACCATCTCCATGGTCCAGAGCTGTTCCGTTGAGGAGCCGGAACAGGTC
GAGTGCGGGTGTGGGTGTGGCAAGCCGCAGTGCCTCTCTTGCGGATCCAG
ATCCTGCGGATGTGGCTGCAACCCCTGTCGATGTCCTTCCTCTTCCGGGT
GTGGCTGCAAGGATTAAAAGCTTTCTAGACCAT
BS28090.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:01:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7606-RC | 201 | CG7606-PC | 1..201 | 17..217 | 1005 | 100 | Plus |
CG7606-RB | 201 | CG7606-PB | 1..201 | 17..217 | 1005 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:01:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7606-RC | 1863 | CG7606-RC | 28..228 | 17..217 | 1005 | 100 | Plus |
CG7606-RB | 327 | CG7606-RB | 28..228 | 17..217 | 1005 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:01:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17596563..17596763 | 17..217 | 1005 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 11:01:36 has no hits.
BS28090.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-30 10:50:08 Download gff for
BS28090.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 33..226 | 22..215 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:02:23 Download gff for
BS28090.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 33..226 | 22..215 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:36:58 Download gff for
BS28090.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 33..226 | 22..215 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:36:58 Download gff for
BS28090.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17596568..17596761 | 22..215 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:02:23 Download gff for
BS28090.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13422290..13422483 | 22..215 | 100 | | Plus |
BS28090.pep Sequence
Translation from 16 to 216
> BS28090.pep
MFNIKLIILVALTISMVQSCSVEEPEQVECGCGCGKPQCLSCGSRSCGCG
CNPCRCPSSSGCGCKD*
BS28090.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:24:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7606-PC | 66 | CG7606-PC | 1..66 | 1..66 | 380 | 100 | Plus |
CG7606-PB | 66 | CG7606-PB | 1..66 | 1..66 | 380 | 100 | Plus |