Clone BS28090 Report

Search the DGRC for BS28090

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:280
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG7606-RB
Protein status:BS28090.pep: gold
Sequenced Size:233

Clone Sequence Records

BS28090.complete Sequence

233 bp assembled on 2011-09-30

GenBank Submission: KX802702

> BS28090.complete
GAAGTTATCAGTCGACATGTTCAATATAAAGTTAATCATCCTGGTTGCCC
TGACCATCTCCATGGTCCAGAGCTGTTCCGTTGAGGAGCCGGAACAGGTC
GAGTGCGGGTGTGGGTGTGGCAAGCCGCAGTGCCTCTCTTGCGGATCCAG
ATCCTGCGGATGTGGCTGCAACCCCTGTCGATGTCCTTCCTCTTCCGGGT
GTGGCTGCAAGGATTAAAAGCTTTCTAGACCAT

BS28090.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG7606-RC 201 CG7606-PC 1..201 17..217 1005 100 Plus
CG7606-RB 201 CG7606-PB 1..201 17..217 1005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG7606-RC 1863 CG7606-RC 28..228 17..217 1005 100 Plus
CG7606-RB 327 CG7606-RB 28..228 17..217 1005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17596563..17596763 17..217 1005 100 Plus
Blast to na_te.dros performed on 2014-11-27 11:01:36 has no hits.

BS28090.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-30 10:50:08 Download gff for BS28090.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 33..226 22..215 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:02:23 Download gff for BS28090.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 33..226 22..215 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:36:58 Download gff for BS28090.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 33..226 22..215 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:36:58 Download gff for BS28090.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17596568..17596761 22..215 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:02:23 Download gff for BS28090.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13422290..13422483 22..215 100   Plus

BS28090.pep Sequence

Translation from 16 to 216

> BS28090.pep
MFNIKLIILVALTISMVQSCSVEEPEQVECGCGCGKPQCLSCGSRSCGCG
CNPCRCPSSSGCGCKD*

BS28090.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG7606-PC 66 CG7606-PC 1..66 1..66 380 100 Plus
CG7606-PB 66 CG7606-PB 1..66 1..66 380 100 Plus