BS28110.complete Sequence
245 bp assembled on 2012-03-05
GenBank Submission: KX800231
> BS28110.complete
GAAGTTATCAGTCGACATGGACGGAGGAGGGGACAACCAGCTCGCGGTGC
GGTCCTTGGGCAGGCAGCGCGAAGCCTTCTCCCACTACGCGGGTCCACCG
ACGGCCATGCTGCAAGGACCCGATCCTGGCGAAGGAGACGTCCTTGCCCT
GCAGATGGCCATAGAAGCCTTCATTCTAGCCGAACTCGAAGAGGATTCAG
GCTTCGAGTCCGGCAGCGAAGACGACTAGAAGCTTTCTAGACCAT
BS28110.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:24:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9445-RB | 213 | CG9445-PB | 1..213 | 17..229 | 1065 | 100 | Plus |
CG9445-RA | 213 | CG9445-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:24:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9445-RB | 443 | CG9445-RB | 143..355 | 17..229 | 1065 | 100 | Plus |
CG9445-RA | 982 | CG9445-RA | 254..466 | 17..229 | 1065 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:24:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6838590..6838802 | 229..17 | 1065 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 08:24:51 has no hits.
BS28110.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:17 Download gff for
BS28110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9445-RA | 126..338 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:34:27 Download gff for
BS28110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9445-RA | 126..338 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:17:39 Download gff for
BS28110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9445-RA | 254..466 | 17..229 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:17:39 Download gff for
BS28110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6838590..6838802 | 17..229 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:34:27 Download gff for
BS28110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 2726095..2726307 | 17..229 | 100 | | Minus |
BS28110.pep Sequence
Translation from 16 to 228
> BS28110.pep
MDGGGDNQLAVRSLGRQREAFSHYAGPPTAMLQGPDPGEGDVLALQMAIE
AFILAELEEDSGFESGSEDD*
BS28110.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9445-PB | 70 | CG9445-PB | 1..70 | 1..70 | 360 | 100 | Plus |
CG9445-PA | 70 | CG9445-PA | 1..70 | 1..70 | 360 | 100 | Plus |