Clone BS28110 Report

Search the DGRC for BS28110

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:281
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG9445-RA
Protein status:BS28110.pep: full length peptide match
Sequenced Size:245

Clone Sequence Records

BS28110.complete Sequence

245 bp assembled on 2012-03-05

GenBank Submission: KX800231

> BS28110.complete
GAAGTTATCAGTCGACATGGACGGAGGAGGGGACAACCAGCTCGCGGTGC
GGTCCTTGGGCAGGCAGCGCGAAGCCTTCTCCCACTACGCGGGTCCACCG
ACGGCCATGCTGCAAGGACCCGATCCTGGCGAAGGAGACGTCCTTGCCCT
GCAGATGGCCATAGAAGCCTTCATTCTAGCCGAACTCGAAGAGGATTCAG
GCTTCGAGTCCGGCAGCGAAGACGACTAGAAGCTTTCTAGACCAT

BS28110.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9445-RB 213 CG9445-PB 1..213 17..229 1065 100 Plus
CG9445-RA 213 CG9445-PA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG9445-RB 443 CG9445-RB 143..355 17..229 1065 100 Plus
CG9445-RA 982 CG9445-RA 254..466 17..229 1065 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6838590..6838802 229..17 1065 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:24:51 has no hits.

BS28110.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:17 Download gff for BS28110.complete
Subject Subject Range Query Range Percent Splice Strand
CG9445-RA 126..338 17..229 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:34:27 Download gff for BS28110.complete
Subject Subject Range Query Range Percent Splice Strand
CG9445-RA 126..338 17..229 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:17:39 Download gff for BS28110.complete
Subject Subject Range Query Range Percent Splice Strand
CG9445-RA 254..466 17..229 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:17:39 Download gff for BS28110.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6838590..6838802 17..229 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:34:27 Download gff for BS28110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2726095..2726307 17..229 100   Minus

BS28110.pep Sequence

Translation from 16 to 228

> BS28110.pep
MDGGGDNQLAVRSLGRQREAFSHYAGPPTAMLQGPDPGEGDVLALQMAIE
AFILAELEEDSGFESGSEDD*

BS28110.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG9445-PB 70 CG9445-PB 1..70 1..70 360 100 Plus
CG9445-PA 70 CG9445-PA 1..70 1..70 360 100 Plus